SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001368 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001368
Domain Number 1 Region: 9-398
Classification Level Classification E-value
Superfamily Ras GEF 6.02e-94
Family Ras GEF 0.00047
Further Details:      
 
Domain Number 2 Region: 408-488
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000299
Family Polcalcin 0.071
Further Details:      
 
Domain Number 3 Region: 493-549
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001368   Gene: ENSBTAG00000001029   Transcript: ENSBTAT00000001368
Sequence length 608
Comment pep:known chromosome:UMD3.1:29:43590193:43602499:-1 gene:ENSBTAG00000001029 transcript:ENSBTAT00000001368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSSSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IENVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPLELAAHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTALQRAGVITHFVHVAEELLHLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLMVSLDQYQTEDELYQLSLQREPRSKSSPTSPTTCTPPPRPPVLEEWTSAAKPKLDQ
AIMVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISKEEM
VSYFLRSSSMLGGRMGFVHNFHESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSMSLEGSAPSPSPTHTHHRAFSFSLPRPGRRGSRPPEIREEEVQTVE
DGVFDIHL
Download sequence
Identical sequences F1MJ35
XP_010819374.1.76553 XP_010819376.1.76553 XP_010819377.1.76553 9913.ENSBTAP00000001368 ENSBTAP00000001368 ENSBTAP00000001368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]