SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001490 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001490
Domain Number 1 Region: 40-258
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-37
Family WD40-repeat 0.00078
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000001490
Domain Number - Region: 387-428
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0162
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001490   Gene: ENSBTAG00000001120   Transcript: ENSBTAT00000001490
Sequence length 431
Comment pep:known chromosome:UMD3.1:19:21426533:21434772:-1 gene:ENSBTAG00000001120 transcript:ENSBTAT00000001490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRVVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSAFCAVNPKFLAIIVEAGGGGAFI
VLPLAKTGRVDKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTIMVWQIPDYTPVRSI
TEPIITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDMHPDVIHS
VCWNTNGSLLATTCKDKTLRIIDPRKGQVVANNFEEPVALQEMDTSNGVLLPFYDPDSSI
VYLCGKGDSSIRYFEITEEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLH
ERKCEPIVMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDADPVLISLRDGYVPPKH
RELRVTKRNILDVRPPSGPRRSQSASNAPLSQHTLETLLEEIKALREQVQAQEQRITSLE
NMLCELVDGTD
Download sequence
Identical sequences A6QLZ8
ENSBTAP00000001490 NP_001095752.1.59421 NP_001095752.1.76553 XP_005888269.1.15283 ENSBTAP00000001490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]