SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001494 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001494
Domain Number 1 Region: 55-86
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000345
Family CHHC finger 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001494   Gene: ENSBTAG00000001123   Transcript: ENSBTAT00000001494
Sequence length 340
Comment pep:known chromosome:UMD3.1:23:47647768:47663909:-1 gene:ENSBTAG00000001123 transcript:ENSBTAT00000001494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAELPPVEERRRLREELSEFVESCRRTLEEVTASLGWSLDRLEPGEEAAAAEDEVAICP
YDSNHHMPRSSLAKHMMSCRLRRLGYTKEEEDKMYNSDFFYENANVPSITLNKDSQFQII
KQARAAVGNDGDYYNQRLYSSLPIEVPLNHKRFVCDLTQADRLALYDFVVEETKKKRSDS
QIIENDSDLFVDLAAKVNQDNSRKSPKSYLEILAEVRDYKRRRQSYRAKNVHITKKSYTE
VIRDVINVHMEELSSHWQEEQEKEADGADKSEERRSASVDSRHSGGSHLDGECSRHRRDR
SRSPHRRKRNKDKDRGWDSRRRKERDGERHHSHKRRKQKM
Download sequence
Identical sequences E1B7L0
9913.ENSBTAP00000001494 XP_002697643.1.76553 XP_005193024.1.59421 XP_005223950.1.76553 XP_010797652.1.59421 XP_010816917.1.76553 XP_019841665.1.53367 XP_019841666.1.53367 XP_019841667.1.53367 XP_591305.2.59421 ENSBTAP00000001494 ENSBTAP00000001494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]