SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001526 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001526
Domain Number 1 Region: 1795-1843
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000384
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 189-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000466
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001526   Gene: ENSBTAG00000001146   Transcript: ENSBTAT00000001526
Sequence length 2442
Comment pep:known chromosome:UMD3.1:9:81237678:81266493:-1 gene:ENSBTAG00000001146 transcript:ENSBTAT00000001526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTGDTALGQKATSRSGETDKASGRWRQEQSAVIKMSTFGSQEGQRQPQIDPEHIGNTAS
AQLFGSGKLASPSEVVQQVTEKQYPPHRPSPYSCQHSLSFPQHSLPQGVMHSNKPHQSLE
GPPWLFPGPLPSVASEDLFSFPIHSHSGGYPRKKISNLNPAYSQYSQKSIEQSEDAHKKE
HKPKKPGKYICPYCSRACAKPSVLKKHIRSHTGERPYPCIPCGFSFKTKSNLYKHRKSHA
HAIKAGLVPFTESAVSKLDLEAGFIDVEAEIHSDGEQSTDTDEESSLFVEASDKMSPGPP
IPLEMASRGGYHGSLEESLGGPMKVPILIIPKSGIPLPNESSQYIGSDMLPNPTLSTKAD
DSHTVKQKLALRLSEKKGQDSEPSLNLLSPHSKGSTDSGYFSRSESAEQQISPPNTNAKS
YEEIIFGKYCRLSPRNTLSVTTTSQERATMGRKGTMDSLPHVNTRLDVKMFEDPVSQLIP
SKAEIDPSQTGMLKSTKFNSESRQSQTIPSSIRNEGKLYPANFQGSNPVLLEAPVDSSPL
IRSNSMPTSSATNLSLPPSLRGSHSFDERMTGSDDVFYPGTVGIPPQRMLRRQAAFELPS
VQEGHLEGDHHGRMSKSITGPSLKEKKLIPGDRVGYDYDVCRKPYKKWEDSETMKQSYRD
ASCISPLKHGGEYFMDPSAPSQGVPTMFGTTCETRKRRKEKSVGDEEDTPMICSSTPLGI
ATADYESKLQMQEGARSGFGLAGQENPSHGHSERFDLCRPPLQSGSPSLGLEESPLSADP
DKQSDGAGRKPPGNVISVIQHTNSLSRPNSFERSESAELAASAQEKASSPSETCDSEISE
APVSPEWAPPGEGAEGTGKPSPAPQVPPPPPPYHAPPRLVRQHNIQVPEIRVTEEPDKPE
KEKETQSKEPEKPVEEFQWPQRSETLSQLPAEKLPPKKKRLRLADMEHSSGESSFESTGT
GLSRSPSQESNLSHSSSFSMSFDREETMKLVASKPDEFGKHSEFLTVPAGSYSLSVPGHH
HHQKEMRRCSSEQMPCPHPTEVPEIRSKSFDYGNLSHAPAAGASAASALSPSRERKKCFL
VRQASFSGSPEISQGEAGVDLGVKQEQLEHLHASLRSTWPHNACSVLPPLPAEDPGKQVV
GPCPQLSSGPLHLAQQQILHLDSQESLRNPLIQPTSYIASKHLSEQSHLFPNQEALPFSP
IQSALFQFQYPTVCMVHLPAQQPPWWQAHFPHPLAQHAPKSYGKPSFQAEVHPSYPLEPL
AEHTGKKSADYAHTKDQTYPGGYSGTSGLPSKNLLPKFPSGESTKSTDTPSEQVLQEDFA
SASAGPLQSLPGTVVPVRIQTHVPSYGSVMYTSISQMLGQNSPAIVICKVDENVTQRTLV
TNAAMQGIGFNIAQVLGQHAGLEKYPIWKVPQTLPLGLESSIPLCLPSTSDSVATLGGSK
RMLSPASSLELFMETKQQKRVKEEKMYGQIVEELSAVELTNSDIKKDLSRPQKPQLVRQG
CASEPKDGLASGSSSFSSLSPSSSQDHPSSSVPSREPVMPGSRASPLGQKSSSGQSESKE
SSDELDIDETASDMSMSPQTSSLPPGDSQLEEQGKGQKLPAGVLVHRASGPSGKVANSTL
LFTDMVDFQQILQFPSLRTTTTVSWCFLNYTKPNYVQQATFKSSVYASWCISSCNPNPSG
LNTKTTLALLRSKQKITAEIYTLAAMHRPGTGKLTSSSAWKQFAQMKPDATFLFGSKLER
KLVGSILKERGKGDIHGDKDIGSKQTEPIRIKIFEGGYKSNEDYVYVRGRGRGKYICEEC
GIRCKKPSMLKKHIRTHTDVRPYVCKLCNFAFKTKGNLTKHMKSKAHMKKCLELGVSMTS
VDDTETEEAETMEDLHKASEKHSMSSISTDHQFSDAEESDGEDGDDNDDDDEDDEDFDDQ
GDLTPKTRSRSTSPQPPRFSSLPVNVGAVPHGVPSDSSLGHSSLISYLVTLPSIQVTQLM
TPSDSCEDTQMTEYQRLFQSKSTDSEPDKDRLDIPSCMDEDCMLSSEPGSSPRDFSPSSR
HSSPGYDSSPCRDNSPKRCLIPKGDLSPRRHLSPRRDLSPMRHLSPRKEAALRREMSQRD
VSPRRHLSPRRPVSPGKEIMARRDLSPRRERRYMTTIRAPSPRRALYHNPPLSMGQYLQA
EPIVLGPPNLRRGLPQVPYFSLYGDQEGAYEHPGSSLFPEGPNDYVFSHLPLHSQQQVRA
PIPMVPVGGIQMVHSIPPALSGLHPPPTLPLPMEGSEEKRGASGDSFAKDPYAVSKQHGK
RSPYAPQSSGPPSMPSSPRLLMKQSTSEDSLNATEREQEENIQTCTKAIASLRIATEEAA
LLGADQSARGQAPHQKPLESAQASIRHFSGPEPGQPCTSASHPDLHDGEKDNFGTSQTAF
AHSTFYSKSCLDDQQSGFQESKELPSSTEAGKEPASEKSQLH
Download sequence
Identical sequences E1B842
ENSBTAP00000001526 9913.ENSBTAP00000001526 XP_005211057.1.76553 XP_010806942.1.76553 XP_010806943.1.76553 XP_015320330.1.59421 XP_015320331.1.59421 XP_015320332.1.59421 XP_015320333.1.59421 XP_015328375.1.76553 ENSBTAP00000001526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]