SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001640 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001640
Domain Number 1 Region: 165-417
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 5.1e-79
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0000853
Further Details:      
 
Domain Number 2 Region: 1-139
Classification Level Classification E-value
Superfamily SNARE-like 2.88e-39
Family Clathrin coat assembly domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001640   Gene: ENSBTAG00000001243   Transcript: ENSBTAT00000001640
Sequence length 418
Comment pep:known chromosome:UMD3.1:27:36716852:36734481:1 gene:ENSBTAG00000001243 transcript:ENSBTAT00000001640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVY
RHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNG
FPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAY
FDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFK
RWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQT
MGKTIEGVTVTSQMPRGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMSL
QAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT
Download sequence
Identical sequences E1B763
ENSBTAP00000001640 9913.ENSBTAP00000001640 ENSBTAP00000001640 NP_001180169.1.59421 NP_001180169.1.76553 XP_010844676.1.44457 XP_017897621.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]