SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001655 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001655
Domain Number 1 Region: 394-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000324
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 2064-2112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000211
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Domain Number 3 Region: 937-965
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000366
Family C2HC finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001655   Gene: ENSBTAG00000001252   Transcript: ENSBTAT00000001655
Sequence length 2671
Comment pep:known chromosome:UMD3.1:23:44139450:44196032:-1 gene:ENSBTAG00000001252 transcript:ENSBTAT00000001655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDKIEEAQKELNGAEVSKKELLEAGIKGTSESLKGVKRKKIVAENHLKKIPKSPLRNPLQ
AKHRQNTEESPFPLLAGAAEPHKKQSHSPAKAGGRPLTKHNGETPGLTAGAPKPEAPVCP
RKPPLLLQPSEPRRWRSEGPDLAKAGVPEGKSDPGSPPSKGKAEHREAPASSGHSSPPSS
FANTAFDVLLKAMEPELSTLSQKGSPCAAKIENLRPNKTARAPTHLHGGPREAADPHLPD
AAAPSEQPLPPRTLYPSGPVSATQRRDPAVVPASSPAYHIHELPVPKHGPQSQQLPACSG
FPPSLASLQGQENAQLEHVYTAAATSPPGRTQVTPSNQQVDAAVSVPVSPTPSTQSPPTP
IYNSSPVAAVVNHSVEQMCSLLLKDQKPKKQGKYICEYCNRACAKPSVLLKHIRSHTGER
PYPCVTCGFSFKTKSNLYKHKKSHAHTIKLGLVLQPDAGGLFVSHESPKALSIHSDVEDS
GDSEEDGAGDERPNDPGSVDLQPVQMIRMLSSSEALPKSGSIPSNPERMVGDFALQDGSS
ESQAVAELPKVVVHPISVSPLRVDSPKVTDSKPELPGTQKDLQGTRVLSHPAWASSLEAD
EKAHQKGDPTQPDGKPESPVGAAHAQLQRQQATDYCQEQQGKLLSPRSLGSTDSGYFSRS
ESADQTVSPPTPFARTLPAPEQDSAKNSGPSTPRVSTPAASAVPAGEKAPLLPGQMRPPL
ATKTLEERISKLISDNEALVDDKQLDSVKPRRTSLSRRGSIDSPKSYIFKDSFQFDLKPM
GRRTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSNSMPTTGYSAVPASIIPAPH
PLRGSQSFDDKIGAFYDDVFVPGPNPSVTQSGHPRTLVRQAAVEDSSASENHVLGAGQPW
DESHPGGSPAGETAAPRSKPPAPGSHLEKKKSHQGRGTMFECETCRNRYRKLENFENHKK
FYCSELHGPKTKVAVRDPEHSSVPGGAQHYRVAGATGVWEQTTQMRKRRKMKSVGDDDEL
QQNESGAPPKSSEGSRSQSALGPAPSLSQQNLAIPSELQPRNLQRQTTQIQLGTRGPNQP
RDPKPSSVLEEPMSSAAQDRAEPKRHGAGISVIQHTNSLSRPGAFDKLDAGEGASPVPFQ
ELRTGKPGSLSVRGISQEEGCPSRHTSQPTLSDAPRGELQDGSRKISGERHVLGQPSRLV
RQHSIQVPEILVTEEPDRDLESQGHDAEKSEKFSWPQRSETLSKLPTEKLPPKKKRLRLA
EMEHSSAESSFDSTLSRSLSRDSSLSHTSSFSASLDVEDVSKTEASPKIDFLHKADFLLI
PAGSNTLSVPGGHREMRRAASEQIHCLQTSMEVSDFRSKSFDCGSIAPSQKVPPAESHPP
TSPSGVGVAGHVPLLERRRGPLIRQISLNIAPENQLAPGNPLSFQTIAPPAVNTVPLQGP
QLTHTVSAEFPASTLHSQTPVKDVRAEMASSHSPNLFPLQQLLGIHLLNQIPVPLSHPDT
HMSLQVSSTQSVKPDASPGGGCVPSKSEDCFAPKYQLQCLAVPSSQPCASNPVQPLPKQG
LSDAAGATPRATSLTLPAKLAEATSNSCPPPPLKVGALGGQVPKGPTSLTLSTHLQTQVS
TYCFAAVTALPQILVTQDLSNQPICQANRSTVPISEEQSSVPKPQNDPRNALPNPEGELV
GQPVFSEMGQNPSPSESSPTTPKMSVGRLSPQQESSASSKRMLSPANSLDIAMEKHQKRA
KDENGAVCATDTRPLEAVGSRAPDGSKQKKPVLVRQVCTTEPLEAVTLEQDVFPHPEVST
EALHLTAVSPADNVSSGHCKPVAREPMKEVQEFESIPSAALLTPTVQNPAAPAEKTHISP
LESIDNHQERKSPGIKNPGNKANVQEQSQPAATTPSMREAGDTQPSTSFPSLKTATSSTW
CCLMRQKALHLPQKDQKTSAYTDWTVSASDPNPLGLPTKVALSLLNSKQKTGKSLYCQAI
TTHFKSDLLVYSSKWKSNLSKRALGNQKSTVVEFSSKDASEINSEQDKENSLIKSEPRRI
KIFDGGYKSNEEYVYVRGRGRGKYICEECGIRCKKPSMLKKHIRTHTDVRPYHCTYCNFS
FKTKGNLTKHMKSKTHSKKCLDLGVSVGLIDEQDTEESDEKQRFSFERSGYDPEESDGAE
DDDIENEEEDEDSQAESVLSAAPSAAASPQHLPARGGPGDPTGADEDASAPEGSPGGPTD
AMDVLPRALPTKMTVLSALPSDRGGSPGSPGSAGPRAAGNAEAAARPPEGAPRSPCHQMS
VDYPNPKEMLSGSAAGKAVALTQGAPCLSLPPPPASERSPQPGGAPPSTSPRPGPQEQKP
QAALPPPAGLPSPQTHLFSHLPLHSQQQSRTPYNMVPVGGIQVVPAGLTYSTFVPIQAGP
VQLTIPAVNVIHRPLGTPGDLSADPGTASPAGVAELSSVVPCIPIGQIRVPTLQSLPALS
METVNIVGLASASLGPPVRPPGLALNAVGLQVVAANPASQSSPAPPAPIPGLQIVNIALP
TLIPSVSQVPVDIQGAPEMPAPPNRASREAPPTQPVGAHPGGRTPSPQGSPGVQRESAQK
GLDPPAPARDQARRDSSSPRDTGKGASANHPKPRHDTPGAPCKPTSAPLPPPGRPRLPLD
PEGPRPPPRRPVTQFSDVSSDDDEDRLVIAT
Download sequence
Identical sequences F1MI25
ENSBTAP00000001655 ENSBTAP00000001655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]