SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001821 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001821
Domain Number 1 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 512-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 70-134
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-22
Family SCAN domain 0.00033
Further Details:      
 
Domain Number 6 Region: 557-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 221-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 334-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000152
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 418-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000914
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001821   Gene: ENSBTAG00000001385   Transcript: ENSBTAT00000001821
Sequence length 615
Comment pep:known chromosome:UMD3.1:21:22702080:22714918:1 gene:ENSBTAG00000001385 transcript:ENSBTAT00000001821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMASEGPRVTAPRSPVVCLPQKEDNQEEEVATVILEDDSWVQEAVLQEDGPETEPFPQGA
GKGSPHEDVAGGPQGALGRLRELCRRWLRPEMHTKEQMLTVLPREIQAWLQEHRPESGEE
AVALVEDLTQTLRDSDFEIQSENWESSNQDIFEDVESHEMFSDVPEGEGIPQSDWESDVE
RDCNPQGPRRNTPRKDRGVVPAPGREAGQLIGLQGTYLGEKPYECPQCGKTFSRKSHLIT
HERTHTGEKYYKCDECGKSFSDGSNFSRHQTTHTGEKPYKCRDCGKSFSRSANLITHQRI
HTGEKPFRCAECGKSFSRSPNLIAHQRTHTGEKPYSCPECGKSFGNRSSLNTHQGIHTGE
KPYECKECGESFSYNSNLIRHQRIHTGEKPYKCPDCGQRFSQSSALITHRRTHTGEKPYQ
CGECGKSFSRSSNLATHRRTHLVEKPYKCGECGKSFSQSSSLIAHQGTHTGEKPYECRTC
GESFSWSSNLLKHQRIHTGEKPYKCGECGKGFSQRSQLVVHQRTHTGEKPYKCLMCGKSF
SRGSILVMHQRAHLGDKPYRCPECGKGFSWNSVLIIHQRIHTGEKPYKCPECGKGFSNSS
NFITHQRTHLKEKLY
Download sequence
Identical sequences A6QPD1
ENSBTAP00000001821 ENSBTAP00000001821 9913.ENSBTAP00000001821 NP_001094660.1.59421 NP_001094660.1.76553 XP_010815278.1.76553 XP_019839505.1.53367 XP_019839506.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]