SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001846 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001846
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily SNARE-like 5.04e-42
Family Clathrin coat assembly domain 0.0000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001846   Gene: ENSBTAG00000001407   Transcript: ENSBTAT00000001846
Sequence length 193
Comment pep:known chromosome:UMD3.1:21:21679213:21720406:-1 gene:ENSBTAG00000001407 transcript:ENSBTAT00000001846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSD
YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYIL
QEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEMPRNINIG
DLNIKVPNLSQFV
Download sequence
Identical sequences Q1JQA3
NP_001068844.1.59421 NP_001068844.1.76553 XP_004017801.1.66739 XP_005695033.2.57651 XP_005895211.1.15283 XP_005977233.1.78601 XP_006058278.1.26621 XP_006192641.1.101512 XP_006198514.1.17985 XP_010839340.1.44457 XP_010953375.1.22495 XP_010985052.1.51371 XP_019839183.1.53367 ENSBTAP00000001846 ENSVPAP00000008069 ENSBTAP00000001846 ENSVPAP00000008069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]