SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001949 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001949
Domain Number 1 Region: 403-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000303
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001949   Gene: ENSBTAG00000001486   Transcript: ENSBTAT00000001949
Sequence length 993
Comment pep:known chromosome:UMD3.1:10:53738934:53840711:1 gene:ENSBTAG00000001486 transcript:ENSBTAT00000001949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FITSFYIFSQIMVQCNLFHRKLDNSKMAELFMECEEEELEPWQKKVKEVDVEPKNSPTFI
WPFTLQNPFISQNILNRVNPSSYSRGIKNGALCRGITPAFKPTSQHYTNPASNPVVASPV
NFHPESRSSDSSVIVQPLSKPGYVTNSSRVVSNNSSELLFDLTQDSGLPHYQAGPALSIT
GMNESSFLSKRPSTSEVNSVNPKKSKPSEGVSGTNSSAVFSSVKSLSVTSPQAVSSKGSN
TSSNQSKNGTPFPRACPKCNIHFNLLDPLKNHMKYCCPDMINNVLGLAKTEISSTANKNK
TIDSEKGKLIMLVNDFYYGKHEGDVQEEQKTYTTFKCFSCLKILKNNIRFMNHMKHHLEL
EKQSSESWENHTTCQHCYRQFPTPFQLQCHIESTHTPHEFSTICKICELSFETEHILLQH
MKDNHKPGEMPYICQVCNYRSSSFSDVETHFRTSHENTKNLLCPFCLKVIKIATPYMHHY
MKHQKKGIHRCTKCRLQFLTCKEKMDHKTQHHRTFIKPKQLEGLPPGTKVTIRASVGPLQ
SGSSTTPSISASTSTLQLSPPRTKNITAKSPTKSNTSKPNITKSIASKPNASKPNGNKPK
YKSKISNLQKKQSTLASSNKKSKVNTALRNLRYRRGVHKCIECYSEIKDFANHFPTYVHC
SFCRYNTSCSKSYVNHMMSFHSNRPSKRFCIFKKYSEDLRGITLVCLNCDFLTDVSGLDN
MATHLSQHETHACQVVIEKVSVCIPTSEHLSELKNEAPTKEQESVSEEIARSNLAEGETE
TSNSESKQDEASSEEIKNGCDVHLFEGSSTTKSEEDISVSDKENDNCLEDQETGSKNIFS
YDSTIDADKVEKEKQVEHICQETELKMCQSSENLIACDQIEDRNAGEARFSSKNIKDLRL
TSGDVSIDQFLRKRDERESVSSDVSEQGSVHLEPLTPSEVLEFEATEILQKGSGDPSAKT
DAVVSDQTDNVPGENSLSTTETTGDLVDEKERS
Download sequence
Identical sequences F1MNG4
ENSBTAP00000001949 ENSBTAP00000001949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]