SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001978 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001978
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily POZ domain 7.65e-32
Family BTB/POZ domain 0.000000977
Further Details:      
 
Domain Number 2 Region: 583-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 624-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 527-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000269
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000001978
Domain Number - Region: 495-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0782
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001978   Gene: ENSBTAG00000001511   Transcript: ENSBTAT00000001978
Sequence length 706
Comment pep:known chromosome:UMD3.1:1:80179482:80202388:1 gene:ENSBTAG00000001511 transcript:ENSBTAT00000001978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVPAIKPPREDFLNSRMLMPQDIMAYRGREVVENSLPLRNAPGCESRAF
APSLYNGLSTPPASYPVYGHLPVSSFLFSDEELRDARMPIANPFPKDRALPCDSARPVPS
EYSRPAMEISPSVCHSTIYSPKEAAPEEARSDMHYSVAEGPKPAAPSARSAPYFPCDKAG
KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQTSG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYAAPPACQPPMEP
DSLDLQSPTKLSTSAEDSTIPQASRLNNIVNRSLTGSPRSSSESHSPLYLHPPKCTSCGS
QSPQHAEMCLHAAGPTFPEELGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC
Download sequence
Identical sequences E1B8E6
NP_001193379.1.59421 NP_001193379.1.76553 XP_005201570.1.76553 XP_010852225.1.44457 XP_010852226.1.44457 ENSBTAP00000001978 ENSBTAP00000001978 9913.ENSBTAP00000001978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]