SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001981 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001981
Domain Number 1 Region: 159-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 213-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000198
Family Classic zinc finger, C2H2 0.0014
Further Details:      
 
Domain Number 3 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000274
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 367-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000353
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 5 Region: 339-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000052
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 6 Region: 420-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000773
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000001981
Domain Number - Region: 25-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00061
Family C2HC finger 0.076
Further Details:      
 
Domain Number - Region: 313-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00577
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001981   Gene: ENSBTAG00000001512   Transcript: ENSBTAT00000001981
Sequence length 678
Comment pep:known chromosome:UMD3.1:13:80577980:80612353:-1 gene:ENSBTAG00000001512 transcript:ENSBTAT00000001981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASNEGESFPGSVQSGTTVLVELTPDIHICGICKQQFNNLDAFVAHKQSGCQLTGTSGA
APSTVQFVSEETVPATQTQTTTRTITSETQTITVSAPEFVFEHGYQTYLPTESNQNQTAT
VISLPAKSRAKKPTAPPAQKRLNCCYPGCQFKTAYGMKDMERHLKIHTGDKPHKCEVCGK
CFSRKDKLKTHTRCHTGVKPYKCKSCDYAAADSSSLNKHLRIHSDERPFKCQLCPYASRN
SSQLTVHLRSHTGDAPFQCWLCSAKFKISSDLKRHMRVHSGEKPFKCEFCSVRCTMKGNL
KSHIRIKHSGNSFKCPHCDFLGDSKATLRKHSRLHQAEHPEKCPDCSYSCPSKAALRVHS
RVHCPDRPFKCSHCSFDTKQPSNLAKHVKKFHGDALKSEAAERRDVGRSSGRQAAKLDAK
KTFHCDRCDASFMREDSLRSHKRQHSEYGDGKGADVTVLQFQVDAGKPPAAPLAVGHLQV
PLPPTPAPQFSEGRVKIIVGHQVPQASTIVQAAAAAVNIVQPTLVAPNPEELRGNSRLQI
LRQVNLIAPPPPSGCSSEAAALPQPAVLLTTHDQTEGATLHQTLIPTTPGGPQEGSGNQT
FITSSGITCTDFEGLNALIQEGAAEVTVVSDGGQSIAVATTAPPIFSTSQQELPKQTYSI
IQGGAHPALLCPADSIPD
Download sequence
Identical sequences A5PKJ0
9913.ENSBTAP00000001981 NP_001096757.1.59421 NP_001096757.1.76553 ENSBTAP00000001981 ENSBTAP00000001981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]