SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002120 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002120
Domain Number 1 Region: 991-1041
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000188
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000002120
Domain Number - Region: 807-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00179
Family Classic zinc finger, C2H2 0.052
Further Details:      
 
Domain Number - Region: 749-788
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00231
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 870-920
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00426
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 1131-1181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0102
Family Classic zinc finger, C2H2 0.086
Further Details:      
 
Domain Number - Region: 717-734,778-812
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0176
Family Cytochrome c3-like 0.043
Further Details:      
 
Domain Number - Region: 590-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0292
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002120   Gene: ENSBTAG00000001616   Transcript: ENSBTAT00000002120
Sequence length 1265
Comment pep:known chromosome:UMD3.1:21:22822829:22871700:1 gene:ENSBTAG00000001616 transcript:ENSBTAT00000002120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGLCVDENVSLSHSGSA
SDVPAVSVIVKNTSRQESFEAEKDHIAPSLLHNGFRGSDLPADPHSLGHNCGKFDSTFMN
GDSTRGFPGKLEASKSEPLPTFNQFSPISSPEPEDAIKDNGFGMKPKHSDSYFPPPPGCG
SVGGPVLEALTKFPVPELHMFDHFCKKEPKPEPLPLGSPQEHERGGQKALEVHKELDASR
FFGDALDFSSHPGNSIGEPKGLASELGTGSAFPPRQRLKPAHSKLSSCVAALVALQAKRV
ANVAKEDQTSHTKDPSGPAKEGSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDS
SSKGSPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPSGSPLGSATAE
APSEAPEDEATTLSGVEHFAEVGAQPGSPQSDRKGEECTAKASEPSPSCFSSGARGQKGA
ASGTLEGRKPQQSPAPPASAPAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQ
PTQMSVPLVHQVKKAAPLVLEVFNKVLHSSNPVPLYAPNLSPPADSRIHVPASGYCCLEC
GDAFALEKSLSQHYGRRSVHIEVLCTLCSQTLLFFNKCSLLRHARDHKSKGLVMQCSQLL
VKPISADQMFVSTPANSTAPAAAAPPSPSQPGQASSNASTPLPALPLYPDPVRLIRHSIK
CLECHKQMRDYMAMAAHFQRTTEETEGLTCQVCQMLLPNQCSFCAHQRIHAHKSPYCCPE
CGALCRSAYFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFC
PMAFKTASSTADHSATQHPTQPHRPSQLIYKCSCEMVFNKKRHIQQHFYQNASTAQVGVF
KCPECPLLFLQKPELMQHVKSTHGVPRNVDELSSLQSSADSSSSRPGPRVPAEPPALSVT
ARGSALPSSRWGRPEAHRRAEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKR
YPCRQCEQSFHTPNSLRKHIRNNHDTVKKVYTCGYCTEDSPSFPRPSLLESHISLMHGIR
NPDLSQTSKARPSGGHSPQVNHLKRPVSGVGAAPDTSNGTPVSSTKRHKSLFQCAKCSFA
TDSGLEFQRHIPQHQKDSSTAQCLLCGLCYTSAGSLSRHLFIVHKVRDQEEEEAEAAEPE
EGSGEEVPMETRENGLEESAEEPLVGDSETGRSLGLAQDEDGAQDAPSRPQTSQDRDSHT
PSPQV
Download sequence
Identical sequences F1N5U2
XP_005221883.1.76553 XP_010815259.1.76553 XP_010815260.1.76553 XP_010815261.1.76553 XP_010815262.1.76553 XP_015314669.1.76553 9913.ENSBTAP00000002120 ENSBTAP00000002120 ENSBTAP00000002120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]