SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002476 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002476
Domain Number 1 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000156
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 467-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000161
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000002476
Domain Number - Region: 438-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00052
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number - Region: 554-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00118
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002476   Gene: ENSBTAG00000001904   Transcript: ENSBTAT00000002476
Sequence length 603
Comment pep:known chromosome:UMD3.1:18:14635302:14649693:1 gene:ENSBTAG00000001904 transcript:ENSBTAT00000002476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRDRLGRFLSPAASRQRGSSGRGSCGGGRVRGRPARSGPDVAEAAAVVAARLGWGPARP
CGDAGEDGADEAGTARALAMGHCRLCHGKFSSRSLRSISGRAPGESSERPPPGDRVFIRD
FQRLLGVAVHQDPALSQFICKNCHAQFYQCHGLLTSFLQRVNVPPTGRRKPCAKVGVQPR
MGPEEGACVVDLIASSPQGLRGLVGWVHRHAAGCGALPSLQRTLSSEYCGVIRAMWGCDQ
GHDYTMDADSSCGALLLDSALGVKWTWDKDSAPRLPQHRGFNPTGAAPQSSQGKAAAAGA
ETETLPSMDTSRLPSDGDPVGPGPGPPSQPSLPPGGAPGQLGEKQVPSPTSDDRVKDEFS
DLSEGDFLSEDENDKKQNTQSSDESFEPYPGKKVSGRKSESKEAKKSEEPKIRKKPGPKP
GWKGKPRCEREELPTIYKCPHQGCTAVYRGADGMKKHVKEHHEEVRERPCPHPGCNKVFM
IDRYLQRHVKLIHTEVRNYICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRA
SLKYHMTKHKAETELDFACDQCGRRFEKAHNLNVHMSMVHPLTQAPEAPPRPAAGQVVKA
EPT
Download sequence
Identical sequences E1B6Y2
ENSBTAP00000002476 ENSBTAP00000002476 9913.ENSBTAP00000002476 XP_002694814.1.76553 XP_010842238.1.44457 XP_010842239.1.44457 XP_591505.2.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]