SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002495 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002495
Domain Number 1 Region: 424-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 340-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 300-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000964
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 247-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000235
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 5 Region: 386-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000536
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002495   Gene: ENSBTAG00000001919   Transcript: ENSBTAT00000002495
Sequence length 608
Comment pep:known chromosome:UMD3.1:19:37919482:37932791:1 gene:ENSBTAG00000001919 transcript:ENSBTAT00000002495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHTASSCQELAENRAVHGAGMAQEDSRRGQVPSSFYHGANQELDLSTKVYKRESGSPYS
VLVDTKMSKPHLHETEEQPYFRETRAVSDVHGVKEDRENSDDTEEEEEEEEVSYKREQII
VEVNLNNQTLNVSKGEKGVSSQSKETPVLKTSSEEEEEESEEEATDDSNDYGENERQKKK
EKTVEKVSVTQRRTRRAASVAAAATSPTPRATRGRRKSVEPPKRKKRATKEPKAAVQKAK
CEEKETLTCEKCPRVFNTRWYLEKHMNVTHRRMQICDKCGKKFVLESELSLHQQTDCEKN
IQCVSCNKSFKKLWSLHEHIKIVHGYAEKKFSCEICEKKFYTMAHVRKHMVAHTKDMPFT
CETCGKSFKRSMSLKVHSLQHSGEKPFRCENCDERFQYKYQLRSHMSIHIGHKQFMCQWC
GKDFNMKQYFDEHMKTHTGEKPFICEICGKSFTSRPNMKRHRRTHTGEKPYPCDVCGQRF
RFSNMLKAHKEKCFRVTSPVNVPPAVQIPLTTSPATPVPSAVNTPTTPAPPVSMNPVGTL
PPRPIPHPFSHLHIHAHPHHPHHLPIPPVPHLPPPPALFKSEPLNNRGQGEDTFLRHLAE
KNSAAQHH
Download sequence
Identical sequences F1N440
ENSBTAP00000002495 ENSBTAP00000002495 NP_001180047.1.59421 NP_001180047.1.76553 XP_005220611.1.76553 XP_010814432.1.76553 XP_010814433.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]