SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002717 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002717
Domain Number 1 Region: 248-414,805-980
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.42e-125
Family Mammalian PLC 0.00000638
Further Details:      
 
Domain Number 2 Region: 557-672
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-30
Family SH2 domain 0.0000211
Further Details:      
 
Domain Number 3 Region: 464-577
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-25
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 4 Region: 998-1119
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.05e-24
Family PLC-like (P variant) 0.0027
Further Details:      
 
Domain Number 5 Region: 702-767
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-19
Family SH3-domain 0.00025
Further Details:      
 
Domain Number 6 Region: 2-66
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000123
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 
Domain Number 7 Region: 96-245
Classification Level Classification E-value
Superfamily EF-hand 0.0000000185
Family Calbindin D9K 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002717   Gene: ENSBTAG00000002103   Transcript: ENSBTAT00000002717
Sequence length 1201
Comment pep:known chromosome:UMD3.1:18:8427455:8516798:1 gene:ENSBTAG00000002103 transcript:ENSBTAT00000002717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDIMEIKEIRPGKSSKDFERAKAVRQKEECCFTVLYGSQFILSTLSLAADSKEDAAKWLS
GLKILHQEVMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSAKFLK
DKFLEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFLLGNTDRPDASAVHLH
DFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENSIWDE
KYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDCWDGP
DGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARVFKEV
FGDLLLTKPKEASADQLPSPSQLRGKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELHMW
DPIDQKWTRHYCAVADAKLSFSDDIEQTVEEELPLDIPPTELHFGEKWFHKKVEKRTSAE
KLLQEYCAETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTMKYYLTDN
LMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDMLMRIP
RDGAFLIRKREGTDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYYEKHA
LYRKMKLRYPVTPELLERYNTERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDYRAKQ
SDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISPTEGEEVDKQIIEDNP
LGSLCRGILNLNIRNVVKAPHGKNQKPFVFILEPKKQGDPPVEFATDSVEELFEWFQSIR
EITWKMDAKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETKAD
SIVRQKPSDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKYMQMN
HALFSLNGRTGYVLQPESMRAEKYDPMPPESQRKIQMTLTVKVLGARHLPKPGRSIACPF
VEVEICGAEYDSNKFKTTVVNDNGLSPVWTPTQEKVTFEIYDPNLAFLRFVVYEEDMFSD
PNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSCRQLR
RRQEELNNQLFLYDTHQNLRSATRDALVREFNVNENQLQLYQEKCNRRLREKRVSNSKFY
S
Download sequence
Identical sequences F1N4C7
ENSBTAP00000002717 ENSBTAP00000002717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]