SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002720 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002720
Domain Number 1 Region: 113-227
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.19e-42
Family Frizzled cysteine-rich domain 0.00000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002720   Gene: ENSBTAG00000002107   Transcript: ENSBTAT00000002720
Sequence length 645
Comment pep:known chromosome:UMD3.1:4:8490676:8494829:1 gene:ENSBTAG00000002107 transcript:ENSBTAT00000002720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEEAPKKSRAAGGGGGGGSWELCAGALRTVPAAEGSGDAGSRRRPPADSRRLARRLLL
LLWLLEAPLLLGVRAQAAGQGPGPGQQPPPPQQQQSGQQYNGERGISIPDHGYCQPISIP
LCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQ
ALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSL
LPEFWTSNPQHGGGGHRGGGFAGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCE
PTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGC
YTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWV
ILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGL
NNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFS
VLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGAPPHPPMSPDFTV
FMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
Download sequence
Identical sequences A7MB15
ENSBTAP00000002720 NP_001094518.1.59421 NP_001094518.1.76553 XP_006078420.1.26621 9913.ENSBTAP00000002720 ENSBTAP00000002720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]