SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002726 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002726
Domain Number 1 Region: 377-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.11e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.84e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.66e-24
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 6 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 7-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 656-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-22
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 702-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000153
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000374
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 11 Region: 228-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000303
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002726   Gene: ENSBTAG00000002113   Transcript: ENSBTAT00000002726
Sequence length 758
Comment pep:known chromosome:UMD3.1:X:91031761:91044478:-1 gene:ENSBTAG00000002113 transcript:ENSBTAT00000002726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSKCQDTLVSFEDVTVDFSQEEWQHLDPVQQRLYWDVTLETYSHLCAVGYQVPKPEVIFR
LEQGEGSWTLDKETPHHSCSDEDIGQTQQQRISGEVSFHCEKIGQSIGKDSLCSIIEELW
QGNDQLERNQENRNNPLSHVKVLTKERGYEYKNIEKIIHVSTRLVPSIKRLHNFDTFGKS
LKHTLNLHNHNKSNATKNFDKIFGNGNNFAHSSSFTKNENANIGTNSYELNQCEKHLDHK
QVLAHHQKIHTGEKLYICTEYVNTFTQESHLFEHQRINAGEKSHECNKDENIFTQKPQIE
VPQSVYTREKPFICIQCGKAFTLRSNLITHQKIHTGQKPYKCSECGKAFFHRSYLFRHMR
IHTGEKPYECNECGRGFSQNSDLSIHQKTHTGEKHYACSECGKAFTRKSALRMHQRIHTG
EKPYICTECGKAFIQKSHFNTHQRIHTGEKPYECSDCGKSFIKKSQLHVHQRIHTGEKPY
ICTECGKVFTHRTNLTTHQKTHTGEKPYMCAECGKAFSDQSNLIKHQKTHTGEKPYKCNG
CGKAFIWKSRLKIHQKSHIGERHYECNECGKAFIQKSTLSVHQRIHTGEKPYACPECGKA
FIQKSHFIAHHRIHTGEKPYACSDCGKCFTKKSQLRVHQKIHTGEKPNICAECGKAFTDR
SNLITHQKIHTREKPYKCSDCGKTFTWKSRLSIHQKSHTGERHYECSKCGKAFIQKATLS
MHQIIHTRKKAYACTQCQKAFTDRSNLIKHQKTHSAEK
Download sequence
Identical sequences F1N471
ENSBTAP00000002726 ENSBTAP00000002726 9913.ENSBTAP00000002726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]