SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002751 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002751
Domain Number 1 Region: 384-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000126
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 417-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000303
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002751   Gene: ENSBTAG00000002129   Transcript: ENSBTAT00000002751
Sequence length 454
Comment pep:known chromosome:UMD3.1:12:48104081:48123367:1 gene:ENSBTAG00000002129 transcript:ENSBTAT00000002751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRVLTMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFSGEELKHPHHHPQA
QPAPPQPAPPPAAGPRLPAEELVQTRCEMEKYLTPQLPPVSIIPEHKKYRRDSASVVDQF
FTDSEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVTIFSHQSETTAPPPAPT
QALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPPQQGHLYQLLNTPDLDMPSST
NQTAVMDTLNVSMSAAMAGLNTHTSAVPPTAMKQFQSMPPCTYTMPSQFLPQQATYFPPS
PPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPATLPVTSQNIQPVRYNRRS
NPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRH
YRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
Download sequence
Identical sequences A4IFB2
9913.ENSBTAP00000002751 ENSBTAP00000002751 NP_001077196.1.59421 NP_001077196.1.76553 ENSBTAP00000002751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]