SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002792 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002792
Domain Number 1 Region: 71-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 128-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 253-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000199
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 174-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000157
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002792   Gene: ENSBTAG00000021222   Transcript: ENSBTAT00000002792
Sequence length 314
Comment pep:known chromosome:UMD3.1:25:26840152:26848526:1 gene:ENSBTAG00000021222 transcript:ENSBTAT00000002792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEQQTEEEEEEEMQEEMVLLVKGEEEEGEEKYEVVKLKIPMDNKEVPSEAPAPSADPA
RPHACRDCGRAFARRSTLAKHVRIHTGERPFACTECGRRFSQKSALTKHSRTHTGERPYE
CPECDKRFSAASNLRQHRRRHTGEKPYACAQCGRRFAQSSNYAQHLRVHTGEKPYACPDC
GRAFGGSSCLARHRRTHTGERPYACADCGTRFAQSSALAKHRRVHTGEKPHRCPVCGRGF
GHRSNLAEHARTHTGERPYPCSECGRRFRLSSHFIRHRRAHMRRRLYICAGCGRDFKLPA
GATATERCPDCEGS
Download sequence
Identical sequences F1N3Y9
XP_005224883.1.76553 XP_020740354.1.74333 XP_020740355.1.74333 XP_020740356.1.74333 9913.ENSBTAP00000002792 ENSBTAP00000002792 ENSBTAP00000002792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]