SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002822 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002822
Domain Number 1 Region: 1635-1734
Classification Level Classification E-value
Superfamily Plakin repeat 2.62e-18
Family Plakin repeat 0.0085
Further Details:      
 
Domain Number 2 Region: 242-367,558-589
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000133
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 3 Region: 670-781,811-838
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000336
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 4 Region: 117-187
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000432
Family Spectrin repeat 0.008
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000002822
Domain Number - Region: 596-705
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000128
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002822   Gene: ENSBTAG00000002178   Transcript: ENSBTAT00000002822
Sequence length 1734
Comment pep:known chromosome:UMD3.1:25:3966800:4014117:-1 gene:ENSBTAG00000002178 transcript:ENSBTAT00000002822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNKELSELIEQLQKNADQVERNIVDTEAKMQRDLARLQEGQQPEHRDVALQKVSDSEKLL
YMLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYNLVVKEVDPQVNWEALV
EEKLDELSSQGFGTELPLVGQQVEQHNVFHNEVKAIGPHLAKEQNGELQAKYQKLLAASQ
ARQQHLSSLQDYMQRCTNELYWLDQQAQGRIQYDWSDRNLNYPSRRRQYENFIHRNLEAK
EERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFH
KDMKDAQELLRKVDSDLNQKYSPDFKDRYQIELLLRELDDQEKALDKYQHVVRGLQKRGQ
QVVPLKYRRETPLKPIPVEALCDFEGDQGLISRGYSYTLQRNNGESWDLTDSAGNKLTAP
AVCFMIPPTDPEALALAESHSLGSQYQSLRQKAAGSRKALQEQHEVLKAESSGADASDLQ
GRQLLAGLDKVASDLDRQEKAITAILRPPLEQGRAVQDSAERAKDLKNITNELLRIEPEK
ARSTAEGEAFVRALPDSGSTALLRTRVEDTQRRYERLVQLLEAAQEKLDIANRLEKSLQQ
GREMLATYETQLAQEDTVPESGQALDSRRQELAAMASELQARKALLGEVQRNLQAAKQCS
GSLASRFQEHCPDLERQEAEVHKLCQRFDGLCQQAELRVQSLQSARAEHDAFCSGRDRLL
QFLSHIPSYEPQETDGLGQVETKLNNQKNLLDEIARREEEVQKVHTHSQQYQQAVKDYEL
EAEKLRSLLDLENGRSSHVSKRARLQSPATKVREEEAALAAKFTEVNAINRQRLQNLEFA
LTLLRQLEAGASQEALPGSKPGPGAEETWKIQEELDEEMERRQQLEHEVRSAQEEIRALR
SQSPQEAVVTREVLRKVPDPALEESFQQAQQTLAEEQHKNRLLQGEVEALRLRLRALEEA
ARAGGQEYVVKEVLRIEPDRAQADEVLRLRGELEVLRRQKGAREAEALLLQQRVAALAEE
KRRAREVVTEKEVVKVHNDPQLEAEFRQLQEDQQREQGLREKQEEELGFLQDKLKRLEKE
RAMAEGKITVKEVLKVEKDVAAEREVGALQRRYEDEAARARASQREKTELLRKIWALEEE
NAKVVVQEKVREIVRPDPKAESEVANLRLELVEQERKYRGAEEQLKSYQSELEALRRRGP
QVEVKEVTKEVIKYTTDPETEKELQRLREEIVDKTRLIERCDLEIYQLKQEIQSLKEAKP
QVQTKEVVQEILQFQEDPQTKEEVAALRARLAEEHKKQVDLERECVSQEEKIQEKEEELA
RGKEVVVQQEVVRYEEEPGLRAEVSAFTESIDAELRQIDGLRGELRRLQRRRAELEHQLE
ELERERQARREAELEVQHLKQQLAQLEAQEGEAHEKVTLTQKVVLQQDPQQAREHALLAL
QLEEERHRRQGLERELETLKQQLEHLEKMEVKEKVVFSESVQVEKGDTEQEIERLRGSLE
AESRGKRELDAEVSRLEAKLSELEFCNSKSSKELDFLREENHKLQLERQSLQLEARRLQS
EIEMAKAEAQSLRSLPTTTGADPGAQLDSRLRSLERELDDLRRLSRDKDQEIEELQRRLG
SVAIKREQRENHLRRSIVVIDPDSGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK
GPGGESSVIHDRKSGRKFSIEEALQSGRLTPAQYDRYVNKSMSIQELAVLVSGQ
Download sequence
Identical sequences F1N2K8
ENSBTAP00000002822 ENSBTAP00000002822 9913.ENSBTAP00000002822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]