SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002963 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002963
Domain Number 1 Region: 354-414
Classification Level Classification E-value
Superfamily Leucine zipper domain 2.08e-18
Family Leucine zipper domain 0.0000413
Further Details:      
 
Domain Number 2 Region: 19-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000033
Family Classic zinc finger, C2H2 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002963   Gene: ENSBTAG00000002295   Transcript: ENSBTAT00000002963
Sequence length 505
Comment pep:known chromosome:UMD3.1:2:21725942:21830229:1 gene:ENSBTAG00000002295 transcript:ENSBTAT00000002963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHSS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTTGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPVLSQIVMAPSSQSQPSGS
Download sequence
Identical sequences F1N177 L8I4M8 W5NPT9
ENSBTAP00000002963 ENSOARP00000000179 ENSBTAP00000002963 XP_005902607.1.15283 XP_005902608.1.15283 XP_006073649.1.26621 XP_010858101.1.44457 XP_010858102.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]