SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003306 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003306
Domain Number 1 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-27
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 286-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.87e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.93e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 173-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.24e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.74e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 551-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 9 Region: 1-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 10 Region: 117-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.41e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003306   Gene: ENSBTAG00000033563   Transcript: ENSBTAT00000003306
Sequence length 608
Comment pep:known chromosome:UMD3.1:18:47193774:47226339:1 gene:ENSBTAG00000033563 transcript:ENSBTAT00000003306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQELVTFRDVVISFSQEEWEYLDSAQRDLYWDVMMENYSNLVSLDLESKYDTKTLSVDK
VIIEKNNSQWEVIENSKLVGLQNSIFRNDWQSQRKTEVQRPEVGSFSQIKIISEKKSFRV
HAQLTRHQKIHTDEKPYKCMECSKDFRFHSQLTEHQRIHTGEKPYKCIQCEKVFRISSQL
IEHQRIHTGEKPYACKQCGKTFGVCRELARHQRIHTGKKPYECKACGKVFRNSSSLTRHQ
RIHTGEKPYKCKECGKAFGVGSELTRHQRIHSGQKPYECKECGKFFRLTSALIQHQRIHS
GEKPYECKVCEKAFRHSSALTEHQRIHTGEKPYECKECGKAFSGKSYLSEHEKIHTGEKP
FECNQCGRAFSQKQYLVKHQNIHSGKKPFKCNECGKAFSQKENLIIHQRIHTGEKPYECK
GCGKAFIQKSSLIRHQRSHTGEKPYICKECGKAFSGKSNLTEHEKIHIGEKPYKCNECGT
IFRQKQYLIKHHNIHTGEKPYECNKCGKAFSRITSLIVHVRIHTGDKPYECKICGKAFCQ
SSSLTVHMRSHTGEKPYGCNECGKAFSQFSTLALHMRIHTGEKPYQCNECGKAFSQKSHH
IRHQRIHI
Download sequence
Identical sequences F1MMM9
ENSBTAP00000003306 ENSBTAP00000003306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]