SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003359 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003359
Domain Number 1 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 175-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 399-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 287-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 7-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.06e-20
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 7 Region: 122-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 446-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000493
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003359   Gene: ENSBTAG00000002594   Transcript: ENSBTAT00000003359
Sequence length 470
Comment pep:known chromosome:UMD3.1:2:130078397:130084459:1 gene:ENSBTAG00000002594 transcript:ENSBTAT00000003359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDPTQRDIYRDVMQENYGNVVSLDFEIRSE
NEVNPKQEISEDVEFETASERPVGNTEENPESEEAFDNRDRSERQWGDLTAEEWVSYPLQ
QVTDLLVHKEVHTSIRYHICSHCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSSH
LIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCNECGKSFCRLSHLIQH
QRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECNECGRGFSERSDLIKHYRVH
TGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQRTHTGEK
PYECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSFGERSDLIKHQRTHTGEKPYEC
VQCGKGFTQSSNLITHQRVHTGEKPYECTECEKSFSRSSALIKHKRVHTD
Download sequence
Identical sequences E1BMZ4
9913.ENSBTAP00000003359 ENSBTAP00000003359 ENSBTAP00000003359 XP_005905228.1.15283 XP_006056621.1.26621 XP_010800943.1.76553 XP_010824979.1.59421 XP_010828331.1.44457 XP_010828332.1.44457 XP_019837170.1.53367 XP_020730151.1.74333 XP_020730152.1.74333 XP_020730153.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]