SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003608 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003608
Domain Number 1 Region: 36-153
Classification Level Classification E-value
Superfamily TPR-like 4.75e-20
Family Tetratricopeptide repeat (TPR) 0.0067
Further Details:      
 
Domain Number 2 Region: 833-871
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Domain Number 3 Region: 885-919
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000275
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 483-512
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000804
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003608   Gene: ENSBTAG00000002782   Transcript: ENSBTAT00000003608
Sequence length 976
Comment pep:known chromosome:UMD3.1:5:112977785:113010230:1 gene:ENSBTAG00000002782 transcript:ENSBTAT00000003608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQRRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQNLFAEGNDLFREKDYKQALVQYM
EGLNVADYAASDQVALPRELLCKLHVNRAACYFTMGLYEKALEDSEKALGLDSENIRALF
RKARALTELGRHKEAYACSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETF
SLLSNGTAAGVADQGTSNGLGSIDDIETDCYVDLRGSPAPLPSTPTMPLFPHVLDLLAPL
DSSSRALPGTESLDDFSDGDVFGPELDTLLDSLSLVQGGLPGGGVPSELPQLIPVFPGGT
PLLPPVVGGSIPVSSPLPPASFGLVVDPSKKLAASVLDALEPPGSGLDSLDLLPYSETRL
DALDSFGSSRGSLDKPSSFLEDTNSQDHRPSSGTQKPAPSPEPSMPNTALLIKNPLAATH
EFKQACQLCYPKTGPRAGDYTYREGLEHKCKRDMLLGRLRSAEDQTWKRIRPRPTKTSFV
GSYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLLFDPLGGVKRGSLTI
AKLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTS
LKYSKVRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYSGMTHEDIVQE
SKKYWQQMEAHTGKASSSLGAPRTHGPSTFDLQMKFVCGQCWRNGQVVEPDKDLKYCSAK
ARHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYDLCIHAQNGRKCQYVGNCSFAH
SPEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPVGSREGEKQIQMPTDYADIM
MGYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAYRFPMGEFRLCDRLQKGK
ACPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDDDFGKYNFLLQEDGNA
PGAALEAPATAAGTGD
Download sequence
Identical sequences E1BIU4
ENSBTAP00000003608 NP_001179728.1.59421 NP_001179728.1.76553 XP_005909492.1.15283 XP_019817434.1.53367 ENSBTAP00000003608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]