SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003635 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003635
Domain Number 1 Region: 280-341
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 731-788
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 673-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 635-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.23e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 544-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-16
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 6 Region: 777-829
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000001
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003635   Gene: ENSBTAG00000002810   Transcript: ENSBTAT00000003635
Sequence length 832
Comment pep:known chromosome:UMD3.1:4:113238978:113261531:-1 gene:ENSBTAG00000002810 transcript:ENSBTAT00000003635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQRSSPLSFPNVLQEETPRQVPAGLPRETLFQSHVLPPKELPSLSPAVSRQGCLPQTP
GAPKQETSGRMPPVLQKGPSLLYPGAPEQETRIQGPLTSPEEPPYPPPAAAEQEMSLLSH
SAHHQEAPLHSPEVPERDPLTLSPTVPETDMDPLLQSPVSQKDTPFQISAAAQKDTPLPT
AEITRLAVWAAVQAVERKLEAQAMRLLTLEGRTGTNEKKIADCEKTAVEFANHLESKWVV
LGTLLQEYGLLQRRLENMENLLKNRNFWILRLPPGSNGEVPKVPVTFDDVAVHFSEQEWG
NLSEWQKELYKNVMRGNYESLVSMDYAISKPDLMSQMERGERPAMQEQEDSEEGEAPADP
SAAHDGIVIKIEVQTNDEGSESLETPEPLMGQVEEHGFQDSELGDPCGEQPDLDMQEPEN
PLEASTEGSGEFSELKQMLVQQRNCAEGIVIKTEEQEEEEEDEEDDELPQHLQSLGQLSG
RYETGLYPTPLPGELSPEGEESPPPLQLGNPAVKRLAPPSHGERHPGENRGSGSQQQRNR
RGERPFTCMECGKSFRLKINLIIHQRNHIKEGPYECAECEVSFRHKQQLTLHQRIHRVRG
GYASPERGPGFTPKHALKPRPKSPSSGGGSGGGPKPYKCPECDSSFSHKSSLTKHQITHT
GERPYTCPECKKSFRLHISLVIHQRVHAGKHEVSFICSLCGKSFSRPSHLLRHQRTHTGE
RPFKCPECEKSFSEKSKLTNHCRVHSRERPHACPECGKSFIRKHHLLEHRRIHTGERPYH
CAECGKRFTQKHHLLEHQRAHTGERPYPCTHCAKCFRYKQSLKYHLRTHTGE
Download sequence
Identical sequences F1MBN9
NP_001179402.1.59421 NP_001179402.1.76553 XP_005205900.1.76553 XP_019814823.1.53367 ENSBTAP00000003635 ENSBTAP00000003635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]