SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003637 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003637
Domain Number 1 Region: 6-312
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.51e-87
Family Calpain large subunit, catalytic domain (domain II) 0.0000031
Further Details:      
 
Domain Number 2 Region: 333-463
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.05e-32
Family Calpain large subunit, middle domain (domain III) 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003637   Gene: ENSBTAG00000002809   Transcript: ENSBTAT00000003637
Sequence length 464
Comment pep:known chromosome:UMD3.1:3:120332023:120339480:-1 gene:ENSBTAG00000002809 transcript:ENSBTAT00000003637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPAKELFRDAAFPASDSSLFSSFSTPLAQFREEITWRRPQEICAMPRLFAGSPQEGQV
KQGLLGDCWFLCACAALQKSRHLLDQVFPPGQPSWLDQTYRGSFTCRVWQFGRWVEVTVD
DRLPCLAGRLCFSRCQREDVFWLPLLEKVYAKVHGSYEQLWAGQVADALVDLTGGLAERW
NLKDVAGSSGQQDGPRGAERRTCRQLLSLKDRCLLSCSVLSPRTGTRELGEFHAFIVSDL
RELQDLAGRSVLLLRIQNPWGRRCWQGPWREGGEGWSQVEPAAQAELLSQLQDGEFWVEE
DEFLREFDEVTIGFPSTEAGHLQSLHSGKVLCHTQELPGAWVKGQSAGGCRNNSGFPSNP
KFWLRVCEPSEVYVGVLQRPRVRAAGRPGRDYQAVGLHLWKVEKRRVNLPRALSAPPVAG
TACHAYDREVHLRCELSPGFYLAVPSTFLKDVPGQFLLRVFSTG
Download sequence
Identical sequences F1MBN8
ENSBTAP00000003637 ENSBTAP00000003637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]