SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003736 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003736
Domain Number 1 Region: 182-451
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 1.14e-63
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0000515
Further Details:      
 
Domain Number 2 Region: 1-141
Classification Level Classification E-value
Superfamily SNARE-like 3.25e-37
Family Clathrin coat assembly domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003736   Gene: ENSBTAG00000002881   Transcript: ENSBTAT00000003736
Sequence length 452
Comment pep:known chromosome:UMD3.1:25:36881739:36885596:-1 gene:ENSBTAG00000002881 transcript:ENSBTAT00000003736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHDDRHFIHIR
HSGLYLVATTSENISPFSLLELLSRLATLLGDYCGSLGEATISRNVALVYELLDEVLDYG
YVQTTSTEVLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSD
QSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSE
LRGYGPGIRVDEVSFHSSVYLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFP
SVQWDRGSGRLQVYLKLRCDLPPKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELGEGA
LRWDLPRVQGGSQLSGLFQMDVPGLPGPPGQGPSASAPLGLGPASLSFELPRHTCSGLQV
RFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI
Download sequence
Identical sequences Q29RY8
ENSBTAP00000003736 NP_001070567.1.59421 NP_001070567.1.76553 XP_006053689.1.26621 XP_011997036.1.54773 9913.ENSBTAP00000003736 ENSBTAP00000003736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]