SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004035 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004035
Domain Number 1 Region: 876-928
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 571-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000354
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 385-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000578
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 608-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000666
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004035   Gene: ENSBTAG00000003101   Transcript: ENSBTAT00000004035
Sequence length 1061
Comment pep:known chromosome:UMD3.1:13:80297262:80313158:-1 gene:ENSBTAG00000003101 transcript:ENSBTAT00000004035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQAKPQHINSEEDQGERQPQQPAPECADAAPAAPAAGAPGAPMNYLGGRGNDELNG
DGAGIKRPRREETHVCEKCCAEFFSFSEFLDHKKNCTKTPPVLILKDSEGPMSSEDLSGT
VLSPQPPSPGRREGHRDNGSGGGAPGDLREKPGAESVLYLKTEAALPPAPQDISYLPKGK
VANTNVTLQALRGTKVAVNQRSADVPPAPVPGAGSLPWVLEQILCLQQQQLQQIQLTEQI
RVQVNMWASHALHAGHAADSLKTLGGHVSQQVSAAVALLSQKAGSAGLPLDALKPAKLPH
ANVPSAGGSASPGLPPFALKPDATRVLPGVLSRLPGALLPQAQGSVLFQSPFSAVALDPS
KKGKGKPPSVSPVEVKLKDEALCRHKCKYCSKVFGTDSSLQIHLRSHTGERPFVCSVCGH
RFTTKGNLKVHFHRHPQVKANPQLFADFHDKTAVGGGLPFALAGPVPLEEAGLSLDSKPA
LAAGTPSVVGLAQNLPSGPHPKDVAGGPLPGDLQPGPSPESEDGSILPGVGPTHPSPRVG
GFPGGGPPEPGSETLKLQRLVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGERPF
PCKVCGRAFSTKGNLKTHLGVHRTSASVKTQHSCPICQKKFTNAVLLQQHIRMHMGGQIP
NTPLPESPCEFAGPEPSAAGENGSPGAPAHDGVMEAIDVDKACPQEAAPSSSSRVLGPLA
GVLAASPTPGLATAASLDAPVKAGLAALVLQRQGSRENGSVESDGLTNDDASSVMGDPEC
ASRSPDVLESTSFQAVSPAHSQAESVKSKSPDADGKGDGSESSRTEMEGRSSVPSTFIRA
QPTYVKVEVPGGFVGPTTMSPGMTPLLAAQPRRQAKQHGCTRCGKNFSSASALQIHERTH
TGEKPFVCNICGRAFTTKGNLKVHYMTHGANNSSARRGRKLAIENTMALLGTDAKRVPEM
FPKEIVAPSVSVDPVVWSQYATMLNGGLAMKTNEISVIQSGGVPTLPVSLGASSVVNNTA
ASKIDGSQSAAGAEVEKPGTADNVPKHQFPHLLEENKIAVS
Download sequence
Identical sequences E1BJZ5
ENSBTAP00000004035 ENSBTAP00000004035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]