SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004147 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004147
Domain Number 1 Region: 401-594
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.57e-49
Family Ypt/Rab-GAP domain of gyp1p 0.0016
Further Details:      
 
Domain Number 2 Region: 572-694
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-28
Family Ypt/Rab-GAP domain of gyp1p 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004147   Gene: ENSBTAG00000003192   Transcript: ENSBTAT00000004147
Sequence length 768
Comment pep:known chromosome:UMD3.1:19:53181379:53245548:1 gene:ENSBTAG00000003192 transcript:ENSBTAT00000004147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGRLLRRASSKASDLLTLTPGGGGGSGPPSVLDGEIIYSKNNVCVHPPEGLQGLGEHH
PGYLCLYMEKDELLGATLILAWVPNSRIQKQDEEALRYITPESSPVRKAPRPRGRRAQSS
GAPHQPSPTEPRSTLIPRDEDILVVAQSIRDTECVSPSPEDGEKLAPGLGTDGPLPALPP
AHSDSGILSAVSSQDGTEEGREPQPEVGEEEGSLELSAEGVSRASSFDSDSEAFSSPFCL
SPISTALAESSSSVFLESESGSPSSMDAHLQFPDGSGLLQPQRWDEPQRAGALEQICGVF
RVDLGQMRSLRLFFSDEACTSGQLVVASRESQYKVFHFHHGGLDKLPDVLQQWKYCAETH
LKDQQVADEKTCMQFSIRRPKLPSSETHPEESMYRRLDVAAWLRHLNALGQVEEEYKLRK
AIFFGGIDVSIRGEVWPFLLRYYSHESTSEEREALRVQKRKEYAEIQQKRLSMTPEEHRA
FWRNVQFTVDKDVVRTDRSNQFFRGEGNPNVESMRRILLNYAVYNPAIGYSQGMSDLVAP
ILAEVLDESDTFWCFVGLMQNTIFVSSPRDEDMEKQLLYLRELLRLTHARFYQHLVSLGE
DGLQMLFCHRWLLLCFKREFPEAEALRIWEACWAHYQTDYFHLFICVAIVAIYGDDVIEQ
QLATDQMLLHFGNLAMHMNGELVLRKARSLLYQFRLLPRIPCSLHDLCKLCGTGMWDSGY
MPAVECTGQHPGSESCPYGGTVEMPSPKPPREGRKGPKTPREGFSFRR
Download sequence
Identical sequences E1BI57
ENSBTAP00000004147 NP_001193200.1.59421 NP_001193200.1.76553 XP_005221259.1.76553 ENSBTAP00000004147 9913.ENSBTAP00000004147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]