SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004184 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004184
Domain Number 1 Region: 82-261
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.14e-64
Family Brix domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004184   Gene: ENSBTAG00000003225   Transcript: ENSBTAT00000004184
Sequence length 291
Comment pep:known chromosome:UMD3.1:2:1247984:1252957:1 gene:ENSBTAG00000003225 transcript:ENSBTAT00000004184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRREARLRREYLYRKAREEAERTAQERKDKVRRALEENRLIPTELRREALALQGSLEFD
DAGGEGVTNHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHE
VGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTAS
EAKPHLIMHGFSSRLGKRVSDILRYLFPVPKDDSRRVITFANQDDYISFRHHVYKKTNHR
NVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTAHKRVFLSAE
Download sequence
Identical sequences Q0VD01
ENSBTAP00000004184 ENSBTAP00000004184 9913.ENSBTAP00000004184 NP_001069085.1.59421 NP_001069085.1.76553 XP_010800080.1.76553 XP_019824288.1.53367 XP_019824295.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]