SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004230 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004230
Domain Number 1 Region: 543-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 210-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 166-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000252
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004230   Gene: ENSBTAG00000003267   Transcript: ENSBTAT00000004230
Sequence length 606
Comment pep:known chromosome:UMD3.1:18:65878289:65880106:-1 gene:ENSBTAG00000003267 transcript:ENSBTAT00000004230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCWPVVEDEEVPSEKNASGEVVSQVKTPSVPPSMQKADSCDTCEPLLKDILQLDNHQRHT
GETSCTCLAYGREFWFGVNLHQHPEYNGEKPFQWHRDRDLFVKSSTGSLSEKPITCGLGG
QDVSDGHDLLQPPSTDGSGEPHSSTKGREASLHLFSSGQLEEVQSSQKPFNCSDSGKAFQ
KTSVLLSHQSTRSEETPFRCTRAENSLEEKSALISDQWFHTGETSHVCKECGKAFSHPYQ
LRKHQKFHTGVKDYACSDCGKTFSHKLTLIHHQRIHTGERPYECSECGKAFNNRSHLARH
EKVHTGERPFKCSKCGRAFSQSSNFLRHQKVHTHIKPYECSQCGKAFSRSSALMQHWRVH
TGERPFECGECGRAFNNNSNLAQHQKVHTGERPFGCSECGRDFSQSSHLLRHQKVHTGER
PFACGECGKTFSNSSTLIQHQKVHTGQRPYRCSECRKAFSRNSSLVQHWRTHTGEKPYEC
SECGKAFAHSSSLIEHWRVHTRERPYECNECGKFFSQKSILTKHQKVHTGERPYECTKCG
KFFSRKSSLIYHWRVHTGERPYECSACGRAFSSNSHLIRHQRVHTQERPYECSQCGKAFS
ERSTLV
Download sequence
Identical sequences F1MY83
ENSBTAP00000004230 ENSBTAP00000004230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]