SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004486 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004486
Domain Number 1 Region: 56-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.37e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.25e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 688-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 576-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 634-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 730-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 355-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000583
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 10 Region: 285-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000022
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004486   Gene: ENSBTAG00000003456   Transcript: ENSBTAT00000004486
Sequence length 792
Comment pep:known chromosome:UMD3.1:18:65645367:65667374:-1 gene:ENSBTAG00000003456 transcript:ENSBTAT00000004486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWGSWGILMDQSWGMTTVDPWASWALCPQDSTWQMEETAEERRRAPGLPTAQAQE
PVTFNDVAVDFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQITKPEVISLLEQGEEP
WSMEPAYPLQGTCPEWMKNLESKALIPTQSILEEEQSHSMKLERYIWDDPWFSRLEVLGC
KDQLEMYHVNQSTAMRQMVFMQKQILSQRGSEFCELGAGCSQSLNIVPSQKVSQVEHFYK
PDVNAESWRCNSAIMYTDKITCENNEYDKAFYQSMQPVHPARVQTGDNLLKCTDTVKSFN
HILHFGDHMGMHTGEKLYEYKECHQIFNQSPSFNDPGIHIGGNQYDYKEYENIFYFSSFM
EHQKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYATEKPYEYNECGTSFIWSSYLIQHKK
THTGDKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTG
EKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPF
KCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQE
CGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKS
FSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNES
SSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICNNCGKAFTGHSALL
QHQRIHSEEKLC
Download sequence
Identical sequences E1BLQ2
9913.ENSBTAP00000004486 ENSBTAP00000004486 ENSBTAP00000004486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]