SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004502 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004502
Domain Number 1 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.13e-27
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.11e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 5 Region: 250-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 12-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.16e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 7 Region: 599-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 211-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 380-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000239
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 10 Region: 296-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000796
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004502   Gene: ENSBTAG00000003462   Transcript: ENSBTAT00000004502
Sequence length 657
Comment pep:known chromosome:UMD3.1:18:65676642:65689192:1 gene:ENSBTAG00000003462 transcript:ENSBTAT00000004502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAGLLTAGDPDQVTFEDVVVDFTQEEWGHLEPAQRTLYRDVMLETFGLLVSVGHWLPKP
DVISLLEQEAELWAADKGGPRGVCPDLETRPQSKLSTENQGVTEEIPNSALVERFLQESL
WHSKDEGAAGHREQGPEKSDSCVVQAACTLVKTLTEEQQQGDGCGENLSLRPDLPTQPMT
PERQGAPTWGTHGQRENPDSNAQQKTCAKEKPYGCQECGKAFSHSLALIEHHRTHTGERP
YECPECGKGFRNSSALTKHQRIHTGEKPYKCAQCGRTFNQIAPLIQHQRTHTGEKPYECS
ECGKSFSFRSSFSQHERTHTGEKPYTCSQCGKAFRQSIHLTQHLRIHTGEKPYQCGECGK
AFSHSSSLTKHQRIHTGEKPYECQACGKAFTQITPLIQHQRIHTGERPYECSECGRAFSQ
STLLTEHRRIHTGEKPYGCNECGKAFSHSSSLSQHERTHTGEKPYACSQCGKAFRQSTHL
TQHQRTHTGEKPYECSDCGKAFSHSSSLTKHQRIHTGEKPYECNECGKAFSQLAPLIQHQ
RIHTGEKPYECNQCGRAFSQSSLLIEHQRIHTKEKPYGCNECGKSFSHSSSLSQHERTHT
GEKPYDCQDCGKSFRQRTHLTQHQRIHTGEKPYECRDCGKAFTHSSSFIKHQRTHTG
Download sequence
Identical sequences Q08DG8
9913.ENSBTAP00000004502 ENSBTAP00000004502 NP_001070284.1.59421 NP_001070284.1.76553 ENSBTAP00000004502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]