SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004507 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004507
Domain Number 1 Region: 116-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.84e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 74-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 298-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-19
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 42-89
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.05e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 340-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000598
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 163-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000716
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004507   Gene: ENSBTAG00000003465   Transcript: ENSBTAT00000004507
Sequence length 387
Comment pep:known chromosome:UMD3.1:18:65700279:65701523:-1 gene:ENSBTAG00000003465 transcript:ENSBTAT00000004507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGKAFGHSVEVTQCGRTQTRETPYRCPDSVRPLSHFTPLGESRRSSPGEKLYKCTECGKC
FKRNSSLVLHHRTHTGEKPYTCNECGKSFSKNYNLIVHQRIHTGEKPYKCSKCGKAFSDG
SALTQHQRIHTGEKPYECPECGKTFNRNSSLILHQRTHTGEKPYRCNECGKPFTDISHLT
VHLRIHTGEKPYECSRCGKAFRDGSYLTQHERTHTGEKPFECTECGKSFNRNSHLIVHQK
IHSGEKPFECKECGKTFIESAYLIRHQRIHTGEKPYGCDQCQKLFRNIAGLIRHQRTHTG
EKPYECNQCGRAFRDSSCLTKHRRIHTRETPYRCPECGKSFRQNSHLAVHQRLHSRAGPG
HCPQCGKTFRRGSALARHQRSHPGEQP
Download sequence
Identical sequences F1N0P5
ENSBTAP00000004507 ENSBTAP00000004507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]