SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004511 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004511
Domain Number 1 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.55e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 708-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 652-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.59e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 10 Region: 750-802
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 11 Region: 510-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.45e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 12 Region: 190-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004511   Gene: ENSBTAG00000038926   Transcript: ENSBTAT00000004511
Sequence length 813
Comment pep:known chromosome:UMD3.1:18:64607953:64637981:1 gene:ENSBTAG00000038926 transcript:ENSBTAT00000004511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVTFDDVAVTFTQEEWGHLDPAQRTLYQEVMLENCGLLVSLGPGCPVPRPELIYRLEHGQ
ELWTVKRDLSRSTCAGDKGKPKTRESTTSEPSLFEGASVQEQLTQRVSEDSQLGQINNQE
EPLERHEGCLRPEIEPQNGKLPGNPSCERGSLGTAGGVCSRIVEEQVPLGGAVHDRDSCG
SGKDPLIQEEESLFKCNECGKVFNKKRLLARHERIHSGVKPYECTECGKTFSKSTYLLQH
HMVHTGEKPYKCMECGKAFNRKSHLTQHQRIHSGEKPYKCSECGKAFTHRSTFVLHNRSH
TGEKPFVCKECGKAFRDRSYLMWHQQTHTGEKPYECSECGKAFCESAALIHHYVIHTGEK
PFECLECGKAFNHRSYLKRHQRIHTGEKPYVCTECGKAFTHCSTFILHKRAHTGEKPFEC
KECGKAFSNRADLIRHFSIHTGEKPYECTECGKAFNRRSGLTRHQRIHSGEKPYECMECG
KTFCWSTNLIRHSIIHTGEKPYECSECGKAFSRSSSLTQHQRVHTEEESLFKCNECGKVF
NKKHLLAGHEKIHSGVKPYECTECGKTFIKSTHLLQHHMIHTGERPYECMECGKAFNRKS
YLTQHQRIHSGEKPYKCSECGKAFTHRSNFVLHKRRHNGGENPYECFECGKVFKHKSYLM
WHQQTHTGEKPYECSECGKAFCESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQR
IHTGEKPFVCTECGRAFTHCSTFILHKRAHTGEKPFECKECGKAFSTRKDLIRHFSIHTG
EKPYECTECGKAFNRRSGLTRHQRIHSGEKPYE
Download sequence
Identical sequences F1N0P1
ENSBTAP00000004511 ENSBTAP00000004511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]