SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004584 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004584
Domain Number 1 Region: 60-189
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000326
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 2 Region: 214-327
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 3 Region: 602-743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000777
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 4 Region: 514-609
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000396
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 5 Region: 436-553
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000705
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000004584
Domain Number - Region: 798-883
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00683
Family Spectrin repeat 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004584   Gene: ENSBTAG00000003526   Transcript: ENSBTAT00000004584
Sequence length 976
Comment pep:known chromosome:UMD3.1:21:61855015:61963799:-1 gene:ENSBTAG00000003526 transcript:ENSBTAT00000004584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQQPQEGFDRSVEDARRWMRAVQERLQINDNTQGPRTALEARLRETEKICQLEPEGRVK
VDVVLQAAEALLACCHEDQKTEILARLRDIKAQWEETVTHMVHCHSRIEWVWLHWSEYLL
ARDEFYRWFQKMTVALAPPVELQSSLKEKQWQLSHAQVLLRNADHQAVLLDRLLEEAASL
FNRIGDPSVDEDAQQRMKAEYDAVKAKAQDRVDFLEQVTREHECFQASVDEFQLWLKAVV
ERVDGCMGRKCRLSTQDRLLALQGIANDFPKGEESLKRLEEQAVGVTQNTSPLGAEKITR
DLEEMRDVLEKLRGLWEEEQGRLRDLVKSKGACEQQRGQLEAELTEFRKDLQRLAEEGLG
TTAKAATEDELVARWRLYLATREALATEEPRVDRLQAQLKELIVSLQDPKPLSDSVVAAI
QEYQRMKAKSSRLRNAAATELWQRFQRHPQDLQLWRELAQRLLDVTASLPDPPSIHTFLP
QIEAALTESSRLKEQLTMLQLKKDLLGSIFGQERATALLEEVATSVRDRDLLHNRLLQRK
SKLQSLLAQHKDFGATFEPLQKKLSDLQIRVQAENGLRRDLPEKQAQLLRLQGLQEEEMD
LGSQVEAMRPLFQGNPNHQHKMDQLSAAHQALQRSLEDLLEGRQQSLREHCTFNHELLKL
RHWISVITQKLEAHRGDTGPWDAQSQETEVERLLAEFPEKEAQLLEMEALGRLVMEASSL
EGAALVQGELEELTESWRALRQLEESLLSLTRNRQLQRMTEVDSGKKMIFTNNIPKTGFL
ILPTDLTSRHRRQAGLLQGQGGSHEDYSQSLRNFEDWLQEENSKLVRIIAMKTATAEDLR
TRATKLQELEARIPEGQHLFENLLRLRPASESSDELEDLRYRWMLYKSKLKDSSHLLTQS
PLGEPTGFRKAARWRGLSSLCRKVCCVALPLQLLLLLFLLLLFLLPVGEENRSCFLANNF
ARSLTLMLRYDGPPPT
Download sequence
Identical sequences E1BJU6
NP_001192798.1.59421 NP_001192798.1.76553 XP_010815552.1.76553 9913.ENSBTAP00000004584 ENSBTAP00000004584 ENSBTAP00000004584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]