SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004602 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004602
Domain Number 1 Region: 409-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-25
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 325-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-21
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 5 Region: 506-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 283-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.79e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 371-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000279
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000116
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 9 Region: 189-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000013
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004602   Gene: ENSBTAG00000003541   Transcript: ENSBTAT00000004602
Sequence length 577
Comment pep:known chromosome:UMD3.1:18:58180500:58183055:1 gene:ENSBTAG00000003541 transcript:ENSBTAT00000004602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLLLQELLTLEDVAVEFNWEEWQLLDSAQRDLYWDVMLENYNNLVSLGYQGTKPDMLSKL
EHGREPCIIENEMRNRICPGIRKGDSYLPEHSRNQRFLKSMQQCNEQNAFRKSVHLSKTH
FTLIQDHIFNLHRKALESSLSLINQKSSYGIKNPVEFNGDEKSFLHSDCGQLYSGIIFPE
STEHISAQFQFLKHQRTHKIEKSLACVESEKPCSRKSQLISHESVHTGEKPSGGNPCEKS
FSRNVTLTKHQKTQTRDTPHLTSEPSKGCTVKSSSPVHHQTCTGEKAYVCSECGKGFTMK
RYLIAHQQTHSGEKPYVCGECGKGFSGKSNLTVHQRTHTGEKPYVCSECGKGFTMKRYLA
VHQRTHTGERPYLCSECGKDFAVKSNLTVHLRSHTGEKSYICGECGKGFTVKSNLMVHQR
THTGEKSYRCNECGKGFTTKLTLIIHQRTHTGEKPYECNECGKAFSQKICLIQHERCHTG
KTPFVCTECGKSYSHKYGLITHQRIHIGEKPYECDECGKAFTTKSVLNVHQRTHTGERPY
GCSDCEKAFSHLSNLVKHKKMHIREMGRSSQVGNAFN
Download sequence
Identical sequences F1MV30
ENSBTAP00000004602 ENSBTAP00000004602 9913.ENSBTAP00000004602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]