SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004683 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004683
Domain Number 1 Region: 11-74
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000145
Family HkH motif-containing C2H2 finger 0.006
Further Details:      
 
Domain Number 2 Region: 78-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000377
Family HkH motif-containing C2H2 finger 0.0066
Further Details:      
 
Domain Number 3 Region: 152-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000235
Family HkH motif-containing C2H2 finger 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004683   Gene: ENSBTAG00000003601   Transcript: ENSBTAT00000004683
Sequence length 623
Comment pep:known chromosome:UMD3.1:X:55653716:55694963:-1 gene:ENSBTAG00000003601 transcript:ENSBTAT00000004683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGRGGSSFKVDTRPCLREDITWNEQEKTELFADNFCHVCGVVLQFESQRISHYESEK
HAQNVRFYFQMHGEQNEVPGKKMKMDVRNFQEHRSEVVDRNKFCGLCHMVFSSSVVAQSH
YVGKVHSKKLKQLMEERGQVSPSRFQPATAFSMRTYDCRICNITFTSLEMFRSHMQGSEH
QLKESIVINLVKKSRKPPESCQDEYTDYIKVQKARGSEPKTCFRKMEEGSLEARGYREAV
DSRSRHRMFEQRSPGETFWTYPGPYNISQTVENQLPHCLPAQSKKTYDSFQDELEDYIKA
QKARGLDPKTCFRKERESSVETHGYREIDSGPRPRMCEQRYSFETSQTYQRPYTTSPVES
QLYHWLPAQSKRTYNSFQDELEDYIKVQKARGLEPKTSFRKISDSSVETHKHREMVDSRL
RPRMFEQKLPFETFQTYPGSYSISQAEENLLPHPLPTHDKKQRLDPVTYCQPTRDYFPEK
PVPLSLSQQDNNSGTYSVESEVYKHLSSGNDTSEHQAGRKRKHQKRRRHMEKGEERPEKE
QSKHKRKKGYGDTGLDKDKGTGEGKRGREKLSVSSGKLKHRKKKKSHGVPSQKEERKHKK
EKKKPVEEKTEEEMLWDESILGF
Download sequence
Identical sequences E1BHF4
ENSBTAP00000004683 ENSBTAP00000004683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]