SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004687 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004687
Domain Number 1 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.27e-27
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 65-122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-22
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 6 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 122-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 9 Region: 23-75
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 10 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000373
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004687   Gene: ENSBTAG00000003606   Transcript: ENSBTAT00000004687
Sequence length 578
Comment pep:known chromosome:UMD3.1:14:2512226:2540475:-1 gene:ENSBTAG00000003606 transcript:ENSBTAT00000004687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LASEELLALFCSRTSVPSLEKVHTGEKPFQCAQCGKIFRHSSDVTKHWRIHRREKPFKCS
ECGKAFNCSSNLLKHQKTHTGEKPYRCKACGKSFKYNSLLLKHQRIHTGEKPYACHECDK
RFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRVHNGEKPYECGECGQAFSQ
SSNLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECPDCGKAFRGRSHF
FRHLRTHTGEKPFACGACGKAFGQSSQLIQHQRVHYREKPHQCVQRGKAFVHSSQVTQPP
RFHSREKPVTCPRCSPSFSQSSSLTQHQRGHPGEEPYACQECAASFKCYSDVVKHQSIHS
GEKPYECSDCGKAFIHSSHVVRHQRIHNGEKPYLCKECGKAFSQSFNLIRHQRIHTGERP
YECAECGKCFSQRSDATKHQRIHTGERLYGCSECGKTFIHSSNVVRHRRIHHRENPYECR
ECGKAFSQSSNLIQHQRVHTGEKPYACQECGRAFSRSSFLSEHRRIHTGEKPYECGECGR
SFRALSGFFRHQRIHTGEKPFHCAQCGRAFRLSFHLIQ
Download sequence
Identical sequences E1BHF3
ENSBTAP00000004687 ENSBTAP00000004687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]