SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004852 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004852
Domain Number 1 Region: 119-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.88e-135
Family Myotubularin-like phosphatases 0.0000000519
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-18
Family GRAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004852   Gene: ENSBTAG00000003726   Transcript: ENSBTAT00000004852
Sequence length 549
Comment pep:known chromosome:UMD3.1:8:7831437:7899876:-1 gene:ENSBTAG00000003726 transcript:ENSBTAT00000004852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGPLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVI
EDGWHSFLPEQEFELYSSTISEWRLSYVNKEFSVCPSYPPAVIVPKAIDDDALRKVATFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRPLN
IAQQARAKGGGFEQEAHYPQWRRIHKSIDRYHILQESLIKLVESCNDQTQNMDRWLSKLE
ASNWLTHIKEILTTACLAAQCLDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRG
FEALIEREWLQAGHPFQQRCAQSAYCNSKQKWESPVFLLFLDCVWQILRQFPCSFEFNEN
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNRPSELSKFTNPLFEANNL
VIWPSVAPQSLQLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNLLRRQLAELE
TEDGVQESP
Download sequence
Identical sequences A7MB43
9913.ENSBTAP00000004852 NP_001094657.1.59421 NP_001094657.1.76553 ENSBTAP00000004852 ENSBTAP00000004852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]