SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005061 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000005061
Domain Number - Region: 355-425
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000275
Family Autophagin-like 0.011
Further Details:      
 
Domain Number - Region: 155-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00199
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 3-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00476
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005061   Gene: ENSBTAG00000003878   Transcript: ENSBTAT00000005061
Sequence length 579
Comment pep:known chromosome:UMD3.1:9:34364851:34389669:1 gene:ENSBTAG00000003878 transcript:ENSBTAT00000005061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSCDICGETVSSEPDMKAHLLIVHMENEVICPFCKLSGVNYDEMCFHIETAHFEQNELE
RNFERINTVQYGISDNRKDSSLQCRADINSSVHSACASNQPKISAQSLPKDGTLKHKDFY
SENLTESRKFLKSTEKQSDRTKIKESIYETMYSPPECPFCGKIEDNSQDMETHVKTKHAD
LLDTPLEDCNQLLYDCPMCGLVCTNYHILQEHVDLHLEESSFGQGVNRVQCSRDLELAQQ
LQQEEDRKRRSEESRQEMEEFQKLQRQYGLDNSGGYKQQQLRNMEIEVNRGRMHPSEFHR
RKADMMESLAIGVDDGKTKTSGIMEALYRYYQNAATDVRRVWLSAGVDHFHSSFGDKGWG
CGYRNFQMLLSSLLQNDAYDDSLKGMSVPCIPKIQSMIEDAWKEGFDPQGASQLNDKLQG
TKAWIGACEIYTLLTSLRIKCRIVDFHKSTGPLGTHPRLFEWILSYYASEREGSPKVVCT
SKPPIYLQHQGHSRTVVGIEEKKNRTLCLLVFDPGCPSREMQKLLKQDMEVSSLKQLRKF
VGNLKHKQYQIVAVEGVLSSEEKIARRQASQVFTAEKIP
Download sequence
Identical sequences G5E563
XP_005210803.1.76553 XP_005896922.1.15283 XP_019822717.1.53367 XP_019822718.1.53367 ENSBTAP00000005061 ENSBTAP00000005061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]