SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005167 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005167
Domain Number 1 Region: 132-193
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 361-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 822-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 417-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 709-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 766-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.7e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 863-915
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 325-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000107
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 672-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000133
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005167   Gene: ENSBTAG00000003953   Transcript: ENSBTAT00000005167
Sequence length 989
Comment pep:known chromosome:UMD3.1:25:39006993:39014435:1 gene:ENSBTAG00000003953 transcript:ENSBTAT00000005167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRTTPDSPAAQLERLDGSECGPDQEEEEEEGKGDQVEALEERLAEEVVVDADVEVDA
TVEAALAGEQSPASGTQECPHGGRDTESPGLQEKALQAFRAPATPRDEDLEREGEGDEEE
EDEDEVDSLTSGSQGLVTFEDVAVYFSLEEWERLDAEQRELYKEVMRENYGILVSLGYPV
PKPDLIFRLEQGEEPWVPDSPRPEEGDIVTGVYTGAWFWTDDIEDHEEDDDEDFLAEVAE
EENEPPGLWSAAYGVGDVPGTWGPDDSDSAQTPEGWGLDPGGLGVLAPGSESKPFLPDRE
PGASLLAPWAFPAAVAVPAGRPETTCDVCGKVFPHRSRLAKHQRYHAAVKPFGCDECGKG
FVYRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLVTHRRIHTGERPYRCAFCGAGFGRR
SYLVTHQRTHTGERPYPCPHCGRSFSQSSALARHQAVHTADRPHCCPDCGQAFRLRADFQ
RHRRGGGCAEPGSEGPRPEPCSETRPAAGPEEAEVGPEGLEGPEIDEADGETEGEAEVRE
AAVEAPTPRSKDDPEPDRRFLGLGNGLGEGEGPSSHPLGFHFPMHPKSWLHPDGFPILGL
PDFGERLPADGRPLPGPLGGRLSLVEGAGLACDPFGGGAGPGGASGLRAFGPAVGGLLAE
PAPAALAEEESPWICSDCGKTFGRRAALAKHQRYHAGERPHRCADCGKSFVYGSHLARHR
RTHTGERPFPCPECGARFARGSHLAAHVRGHTGEKPFVCGVCGAGFSRRAHLTAHGRAHT
GERPYACGECGRRFGQSAALTRHQWAHAEEKPHRCPDCGKGFGHSSDFKRHRRTHTGEKP
FRCTDCGRGFAQRSNLAKHRRGHTGERPFPCPECGKRFSQRSVLVTHQRTHTGERPYACA
NCGRRFSQSSHLLTHMKTHRGAAGAPVQAPAAPVPKAEAPAKGPPSAGTGTGPGEHGSTL
LEFAGGTSFGSEPTAAFAGPSGAYEETIL
Download sequence
Identical sequences E1BGQ4
9913.ENSBTAP00000005167 ENSBTAP00000005167 ENSBTAP00000005167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]