SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005171 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005171
Domain Number 1 Region: 33-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.56e-65
Family LplA-like 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005171   Gene: ENSBTAG00000003965   Transcript: ENSBTAT00000005171
Sequence length 373
Comment pep:known chromosome:UMD3.1:11:4280893:4283779:1 gene:ENSBTAG00000003965 transcript:ENSBTAT00000005171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIPFSMKNCFQLLCNLKVPAAGFKNTVKSGLILQSISNDVYHNLAVEDWIHDHMNLEGK
PVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTT
KKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTL
LCGTDGTFLSSLLKSPYQGIRSNATASTPALVKNLMEKDPTLTCEVVINAVATEYATSHQ
IDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHEQSHVEIKVFI
DVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVLTSILHRTYPGDDELHS
KWNILCEKIKGIM
Download sequence
Identical sequences O46419
NP_777220.1.59421 NP_777220.1.76553 ENSBTAP00000005171 ENSBTAP00000005171 9913.ENSBTAP00000005171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]