SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005175 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000005175
Domain Number - Region: 94-191
Classification Level Classification E-value
Superfamily SET domain 0.00327
Family Viral histone H3 Lysine 27 Methyltransferase 0.06
Further Details:      
 
Domain Number - Region: 205-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0595
Family Classic zinc finger, C2H2 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005175   Gene: ENSBTAG00000003957   Transcript: ENSBTAT00000005175
Sequence length 290
Comment pep:known chromosome:UMD3.1:21:29762148:29766253:-1 gene:ENSBTAG00000003957 transcript:ENSBTAT00000005175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSLRERASHVYQEVSEPQDDDYLYCEKCENFIKSCAVHGLPTFVKDCAVEKGHVNRLAL
SVPAGLSIRPSGIPEAVLGVWNEVSDLPLALHFGSYKGQIIDDEEAANSGYSWLITKGRN
CYEYVDGKDTSWAKWMRYVNCARDDKEQNLVAFLSHRQIFYQTCPVVRPGCELLVWYGDK
YSQELSIKCGSRWKSELMASRAEPKPKIYPCASCSLAFSSQKFLSQHAEHNHPSQILLRT
SARDRLQTKDSCPGNQNHQQQYSDPHSWRDKPEDREVKERPQPLLQSVRL
Download sequence
Identical sequences E1BGA3
ENSBTAP00000005175 9913.ENSBTAP00000005175 ENSBTAP00000005175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]