SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005233 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005233
Domain Number 1 Region: 569-756
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-51
Family DBL homology domain (DH-domain) 0.000000325
Further Details:      
 
Domain Number 2 Region: 764-893
Classification Level Classification E-value
Superfamily PH domain-like 5.28e-34
Family Pleckstrin-homology domain (PH domain) 0.0000181
Further Details:      
 
Domain Number 3 Region: 240-381
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000157
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 52-154
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000314
Family CRAL/TRIO domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005233   Gene: ENSBTAG00000004007   Transcript: ENSBTAT00000005233
Sequence length 1000
Comment pep:known chromosome:UMD3.1:X:23075815:23153236:-1 gene:ENSBTAG00000004007 transcript:ENSBTAT00000005233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDIAFLSGGRGKDDAWIITFPENCNFKCIPEEVIAKVLTYLTSVARQNGSDSRFTIILD
RRLDTWSSLKMSLQKISSSFPGNLHLVLVLRPTSFLQRTFTDIGFRFSQEDFMLKLPVVM
LSSVSDLLTYIDDKQLTTELGGTLQYSHSEWITFRNAIENFALTVKDTAQMLQSFGTELA
ETELPGDIPAMEEILAIRAERYHLLKKDITAVTKEGKFLLTNLEVPDAEGAVSSRLENDQ
PTSGDWQTINKLLTQVHDMEIAFDGFWEKHQLKMEQYLQLWKFEQDFQELVSEAELILNQ
QAELADVTGTIAQVKQKIKKLENLDENSQDLLAKARFVIIHGHRLAASHHYALDLICQRC
NELRYLSDILVNEIRTKRIQLNRTFKMHKLLQQALQCCDEGECLLANQEIDKFQSKEDAQ
KALQDIENFLEMALPFINYDPETLQYEFGIILSPELKVQMQTIQLKLENIRSIFENQQAG
FRNLTDKHVRPIPFVVSASDNLVRSGAPFFSPTQAVGVGYSFFQACKLFSKGKKTWRQNQ
SNTKTEAVYDCQEKRSSAQSSNLDNDNSLDILKNHVLNELIQTERAYVRELFTVLLGYRA
EMDNPEMFVLMPPLLRSKRDVLFGNMAEIYEFHNKLLFKWLLTNIAYAPERVGSCFLERK
DDFQMYAKYCQNKPRSEAIWKKYSECAFFQECQRKLKHRLGLDSYLLKPVQRITKYQLLL
KELLKYSKDCVGSVELKEALDTMLDLLKSVNDLMHQTAINGYIGNLNELGKMIMQGAFSV
WIGHKKGTTKMKDFARFKPMQRHLFLYEKAVVFCKRRVESGEGGDRYPSYSFKHCLKMDE
LGITEYVKGDNRKFEIWNAGKEEVYIVQASNIDMKMMWLKEIRTILLKQQELLTVKNREQ
HNQLTEQNHFSSQQNDEGQHRGFIGAEEPELGHISTMVEVGESITSVQAEANTVWTEMSS
PAKVSDEPEKWSSNYFYSSYDGHEEERPLMKPESEMAVLF
Download sequence
Identical sequences F1MFK9
ENSBTAP00000005233 ENSBTAP00000005233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]