SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005251 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005251
Domain Number 1 Region: 42-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 181-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000967
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 87-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000459
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 4 Region: 120-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000193
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005251   Gene: ENSBTAG00000004022   Transcript: ENSBTAT00000005251
Sequence length 499
Comment pep:known chromosome:UMD3.1:14:25007291:25009296:-1 gene:ENSBTAG00000004022 transcript:ENSBTAT00000005251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGER
PYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKET
FKCEECGKSYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSAGGV
KEKKHPCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQEL
LKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFPSTLQLNLYNTPFQSVQS
SGSAHQMITTLPLGMTCPIDMDAVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYL
MELQGGVPSSSQDSPASSSKLGLEPQLGSLEDSTGDLSLSKSSISISDPLNTPALDFSQL
FNFIPLNGPPYNPISVGSLGMSYSQEEAHSSVSQLPPQSQDLPDPASTIGLGSLHSLSAA
FTSSLSTSTTLPRFHQAFQ
Download sequence
Identical sequences A0A0M3PRY3 A0A0M4B6Y3 E1BEA5 L8IYS2
XP_004011735.1.66739 XP_004011736.1.66739 XP_005192633.1.59421 XP_005192634.1.59421 XP_005215489.1.76553 XP_005215490.1.76553 XP_005889223.1.15283 XP_006041569.1.26621 XP_010837273.1.44457 XP_012017289.1.54773 XP_012017290.1.54773 XP_012017291.1.54773 XP_012017292.1.54773 XP_012039110.1.66739 XP_014945321.1.54773 XP_014953252.1.66739 XP_019829632.1.53367 ENSBTAP00000005251 9913.ENSBTAP00000005251 ENSBTAP00000005251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]