SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005489 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005489
Domain Number 1 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000183
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 2 Region: 202-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000599
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 3 Region: 63-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000149
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000005489
Domain Number - Region: 260-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00146
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005489   Gene: ENSBTAG00000004193   Transcript: ENSBTAT00000005489
Sequence length 508
Comment pep:known chromosome:UMD3.1:19:9007494:9019157:-1 gene:ENSBTAG00000004193 transcript:ENSBTAT00000005489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHEASHHQQQAAQNSLLPLLSSAVEPPDQKPLLPIPITQKPQAAPETLKDAIGIKKEK
PKTSFVCTYCSKAFRDSYHLRRHESCHTGIKLVSRPKKTPTTVVPLISTIAGDSSRTSLV
STIAGILSTVTTSSSGTNPSSSASSTAMPVTQSVKKPSKPVKKNHACEMCGKAFRDVYHL
NRHKLSHSDEKPFECPICNQRFKRKDRMTYHVRSHEGGITKPYTCSVCGKGFSRPDHLSC
HVKHVHSTERPFKCQTCTAAFATKDRLRTHMVRHEGKVSCNICGKLLSAAYITSHLKTHG
QSQSINCNTCKQGISKTCMSEETSNQKQQQQQQQQQQQQQQHVTSWPGKQVETLRLWEEA
VKARKKEAANLCQTSTAATTPVTLTTPFNITSSVSSGTMSNPVTVAAAMSMRSPVNVSSA
VNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPVTITSPMNLPTPMT
LAAPLNIAMRPVESMPFLPQALPTSPPW
Download sequence
Identical sequences A6QQ84
ENSBTAP00000005489 9913.ENSBTAP00000005489 NP_001095697.1.59421 NP_001095697.1.76553 XP_010851217.1.44457 XP_014339079.1.15283 XP_019836569.1.53367 ENSBTAP00000005489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]