SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005577 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005577
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 2.94e-57
Family Calmodulin-like 0.0000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005577   Gene: ENSBTAG00000004259   Transcript: ENSBTAT00000005577
Sequence length 193
Comment pep:known chromosome:UMD3.1:11:87191215:87307998:-1 gene:ENSBTAG00000004259 transcript:ENSBTAT00000005577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIV
RLLQCDPSSASQF
Download sequence
Identical sequences A0A096NIZ8 A0A0D9R4E2 A0A0P6JG75 A0A1S3A5Y1 A0A1S3EYI2 A0A286XYY3 A0A2K5EDS6 A0A2K5J7T3 A0A2K5PNV2 A0A2K5ZQP8 A0A2K6C627 A0A2K6EZI8 A0A2K6L979 A0A2K6PNX3 A0A2K6TJK3 B3VSB7 D2HH90 F6ZAW8 F7B2H5 F7EJ58 G1RU37 G2HG33 G3SJD0 G3STK6 G7PLL1 H0WIV3 H2P6Z3 I3LYQ1 J9P211 L8HKI5 M3WB27 P29105 Q06AT0
ENSBTAP00000005577 ENSCJAP00000012127 ENSCPOP00000018852 10141.ENSCPOP00000018852 9544.ENSMMUP00000036763 9598.ENSPTRP00000020029 9600.ENSPPYP00000014129 9615.ENSCAFP00000005084 9685.ENSFCAP00000008576 9796.ENSECAP00000004344 9913.ENSBTAP00000005577 ENSECAP00000004344 ENSPTRP00000020029 ENSNLEP00000016762 NP_001092434.1.59421 NP_001092434.1.76553 NP_001116598.1.46622 NP_001127778.1.54773 NP_001127778.1.66739 NP_001233306.1.37143 NP_001247917.1.72884 NP_001270093.1.63531 XP_001503603.1.31192 XP_002758084.1.60252 XP_002921558.1.58354 XP_003272779.1.23891 XP_003272780.1.23891 XP_003272782.1.23891 XP_003272783.1.23891 XP_003272784.1.23891 XP_003411932.1.64505 XP_003462754.1.53824 XP_003787436.1.62490 XP_003827003.1.60992 XP_003827005.1.60992 XP_003927264.1.74449 XP_003984554.1.62641 XP_004028878.1.27298 XP_004028879.1.27298 XP_004028880.1.27298 XP_004091382.1.23891 XP_004091383.1.23891 XP_004091384.1.23891 XP_004274937.1.21590 XP_004401849.1.74151 XP_004436521.1.5094 XP_004582654.1.84141 XP_004609421.1.94378 XP_004642380.1.9945 XP_004665753.1.11716 XP_004686499.1.23501 XP_004745850.1.14098 XP_004745851.1.14098 XP_004745852.1.14098 XP_004870021.2.39548 XP_004870023.1.39548 XP_005000368.1.53824 XP_005213026.1.76553 XP_005327412.1.77405 XP_005404465.1.28644 XP_005404466.1.28644 XP_005576629.1.63531 XP_005630173.1.84170 XP_005911367.1.15283 XP_005967899.1.78601 XP_006073834.1.26621 XP_006073835.1.26621 XP_006073836.1.26621 XP_006073837.1.26621 XP_006073838.1.26621 XP_006140888.1.99106 XP_006197168.1.17985 XP_006745859.1.47382 XP_006869528.1.41390 XP_006898269.1.29581 XP_006910292.1.64745 XP_007456986.1.90284 XP_007529896.1.11023 XP_007933289.1.48129 XP_007969692.1.81039 XP_007969693.1.81039 XP_008160640.1.99482 XP_008582546.1.73410 XP_008848339.1.79516 XP_008950554.1.60992 XP_008979388.1.60252 XP_009440232.1.37143 XP_009440233.1.37143 XP_009440234.1.37143 XP_009440235.1.37143 XP_010336246.1.74449 XP_010377975.1.97406 XP_010377976.1.97406 XP_010808503.1.76553 XP_010808504.1.76553 XP_010850359.1.44457 XP_011747692.1.29376 XP_011747693.1.29376 XP_011747694.1.29376 XP_011816301.1.43180 XP_011816302.1.43180 XP_011816303.1.43180 XP_011816304.1.43180 XP_011820686.1.47321 XP_011820687.1.47321 XP_011820688.1.47321 XP_011820689.1.47321 XP_012294252.1.9421 XP_012294253.1.9421 XP_012294254.1.9421 XP_012294256.1.9421 XP_012294257.1.9421 XP_012294258.1.9421 XP_012294259.1.9421 XP_012294260.1.9421 XP_012294261.1.9421 XP_012294262.1.9421 XP_012511236.1.63892 XP_012634431.1.48125 XP_012868965.1.60039 XP_012908363.1.14098 XP_012908364.1.14098 XP_013975979.1.84170 XP_014199242.1.60992 XP_014586797.1.31192 XP_014967124.1.72884 XP_015329023.1.76553 XP_015982585.1.101085 XP_015982586.1.101085 XP_015982587.1.101085 XP_015982588.1.101085 XP_015982589.1.101085 XP_015982590.1.101085 XP_016077707.1.3490 XP_016798413.1.37143 XP_016798423.1.37143 XP_016798431.1.37143 XP_017381029.1.71028 XP_017381034.1.71028 XP_017506694.1.32401 XP_017709291.1.44346 XP_017709298.1.44346 XP_017911152.1.57651 XP_017911153.1.57651 XP_017911154.1.57651 XP_018876963.1.27298 XP_019307691.1.44245 XP_019307700.1.44245 XP_019307709.1.44245 XP_019505559.1.44202 XP_019505560.1.44202 XP_019604159.1.88060 XP_019604227.1.88060 XP_019604306.1.88060 XP_019826269.1.53367 XP_020748115.1.74333 XP_020748117.1.74333 XP_020748118.1.74333 XP_020748119.1.74333 XP_020748120.1.74333 XP_020941208.1.46622 XP_020941209.1.46622 XP_021553051.1.83697 XP_021553052.1.83697 XP_021583450.1.77405 XP_021583451.1.77405 XP_852217.2.84170 ENSGGOP00000028220 ENSOGAP00000001385 ENSCJAP00000012127 ENSPANP00000012946 ENSPPYP00000014129 ENSAMEP00000012001 ENSTTRP00000004307 ENSOPRP00000010946 ENSFCAP00000008576 ENSOGAP00000001385 ENSSTOP00000001349 ENSNLEP00000016762 ENSCPOP00000018852 ENSMMUP00000036763 ENSGGOP00000028220 ENSBTAP00000005577 ENSFCAP00000008576 ENSLAFP00000003398 ENSTTRP00000004307 ENSPPYP00000014129 ENSMMUP00000036763 ENSCAFP00000039587 ENSLAFP00000003398 ENSCAFP00000039587 ENSOPRP00000010946 ENSPTRP00000020029 ENSECAP00000004344 ENSSTOP00000001349 ENSAMEP00000012001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]