SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005584 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005584
Domain Number 1 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-27
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 2 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 181-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 12-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 475-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 392-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000122
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 8 Region: 224-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000363
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 9 Region: 308-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000389
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005584   Gene: ENSBTAG00000038541   Transcript: ENSBTAT00000005584
Sequence length 529
Comment pep:known chromosome:UMD3.1:7:2241643:2256881:-1 gene:ENSBTAG00000038541 transcript:ENSBTAT00000005584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRLLPAQALVSVTFRDVAVFFSRDEWLCLDSAQRTLYQEVMLENYSTLFSLGILFSKP
KVILRLEQGEDPWMVENGVSQSTYLAGSEGELNSSSMSCTLSYVLCNLNAEHNSMVQTLA
AKMYLSVSKIPEFIYPDGKKYFLTNVSERFINSQVSLSCIKELSPNFITPFLNSNDFSPP
SSSLSKHQRIHTGEKLYKCKECRKAFSQSSSLTQHLRVHTGEKPYICSECGKAFSFTTSL
IGHQRMHTGERPYKCNECGKTFKGSSSLNNHQRIHTGEKPYKCNECGRTFSQCSSLIQHH
RIHTGEKPYECSQCGKAFTSISRLSRHHRIHTGEKPFNCNECGKVFSYHSALIIHQRIHT
GEKPYACKECGKAFSQSSALIQHQRIHTGEKPYKCNECGKAFSWISRLNIHNRIHTGEKP
YNCKECGKAFSSHSAVNTHRKIHTGEKPYKCNDCEKAFNQSSALIQHQRIHTGEKPYNCK
VCGKAFRQSSSLMTHMRIHTGEKPYKCKECGKAFSQSSSLTNHQRTHTG
Download sequence
Identical sequences F1MSI7
ENSBTAP00000005584 ENSBTAP00000005584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]