SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005689 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005689
Domain Number 1 Region: 308-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000249
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 341-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000055
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005689   Gene: ENSBTAG00000033292   Transcript: ENSBTAT00000005689
Sequence length 431
Comment pep:known chromosome:UMD3.1:5:26848177:26855849:1 gene:ENSBTAG00000033292 transcript:ENSBTAT00000005689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSLLEEEAHYGSSPLAMLTAACSKFGSSSPLRDSTTLGKAGTKKPYSVTSDLSASKTM
GDAYPAPFSSTNGLLSPPGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSD
CLPSVYTSLDMAHPYGSWYKAGIHAGISPGPGNAPTPWWDMHPGGNWLGGGQGQGDGLQG
TLPAGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQL
EGSGGAKPPRGAGTGGSAGYGSSGAGRSSCDCPNCQELERLGAAAAGLRKKPIHSCHIPG
CGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCS
KRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPAPPEKAPE
GSPEQSNLLEI
Download sequence
Identical sequences A7MB06
ENSBTAP00000005689 9913.ENSBTAP00000005689 NP_001095612.1.59421 NP_001095612.1.76553 XP_006046708.1.26621 XP_010856227.1.44457 XP_015326434.1.76553 ENSBTAP00000005689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]